KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx11540Help
Entry
Lxx11540          CDS       T00190                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lxx11540 (tpiA)
   01230 Biosynthesis of amino acids
    Lxx11540 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx11540 (tpiA)
   00051 Fructose and mannose metabolism
    Lxx11540 (tpiA)
   00562 Inositol phosphate metabolism
    Lxx11540 (tpiA)
Enzymes [BR:lxx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lxx11540 (tpiA)
Exosome [BR:lxx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lxx11540 (tpiA)
  Exosomal proteins of bladder cancer cells
   Lxx11540 (tpiA)
  Exosomal proteins of melanoma cells
   Lxx11540 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190219..1191022
Genome map
AA seq 267 aa AA seqDB search
MNEAGTSSVRRVPLIAGNWKMNLDHLQSIAVVQKLAWTLKDAGHDFGAVEVAVFPPFTDL
RSVQTLVAADKLPIAFGGQDVSEHDSGAYTGEIAASFLAALEARYVIIGHSERRTLHNET
DEQVAAKTAQAVKNGISPIVCVGETAEDLEKHGASAVPVAQLRAALAGIDSAADFVVAYE
PVWAIGSGQAATPEQAEQVAAALRAVIAEALGDEVAAKTRILYGGSVKSGNIAGFMRETN
VDGALVGGASLDVAEFAAIIRYQKHVI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaggccggaacgtcgagtgtgcggcgtgtgccgctcatcgccggcaactggaag
atgaacctcgatcatctccagtccatcgcggtcgtgcagaagctcgcctggacgctcaaa
gacgccggtcacgatttcggcgcggtcgaggtggcggtcttcccgccgttcaccgatctg
cgcagtgtccagacgctggtcgcggccgacaagcttccgatcgcgttcggcggccaggac
gtctccgaacatgactcgggcgcttacaccggcgagatcgctgcgtcgttcctcgcggca
ctcgaggcccgctatgtgatcatcggccactcggagcggcgcaccctgcacaacgagacc
gatgagcaggtcgcggcgaagaccgcgcaagcggtcaagaacggcatctcgccgatcgtc
tgcgtcggtgagacggccgaagacctggagaagcacggcgcgagcgccgttccggtcgcc
cagctgcgtgcggccctcgcaggcatcgactcggcggcggactttgtcgtcgcgtacgag
cccgtctgggccatcggctcgggccaggcggcgacgccggagcaagccgagcaggtcgcc
gcggcgctccgcgctgtgatcgcggaggcactgggcgatgaggtcgcggcgaagacccgc
atcctctacggcggttcggtgaagtcgggtaacatcgccggcttcatgcgcgagacgaac
gtggacggtgctctcgtcggcggtgcgagcctcgatgtcgccgagttcgccgcgatcatc
cggtaccagaagcacgtgatctga

DBGET integrated database retrieval system