KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx14980Help
Entry
Lxx14980          CDS       T00190                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx14980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lxx14980
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lxx14980
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lxx14980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1560255..1561664
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGGLLGPYSDTLIEGLAPDGGLVVPEELPRLDAELLERWRPLDYAGLAKEVIGL
FATNIPREELSRICRAAYRPEAFASSQIVPLREIDGGMTLVGLSEGPTLAFKDMAMRFLG
ETLDVVLRESDRVLNVLGATSGDTGSAAEHALRGRERLAVFMLSPLGRMSAFQRAQMYSL
LDDNVHNVVVDGVFDDCQNLVKRIAEDLEFKRVHSLGAVNSINFGRISAQIAYYVWAWLR
ATDARGPAEVSFAVPSGNFGNILSGHYARRMGLPVRRLVLATNENNVLDDFFRTGRYRPR
SAADTLPTSSPSMDVSRASNLERFVFDLIGRSAERTAAAWRELEATGEIDLSAEQHRFLP
EFGIVSGTSTHADRLATIRAVAESSGVTIDPHTADGVKVARPLVEPGVPMLVLETAKPEK
FPETIAEALGVAPTPDTATRALLNAAQRVTALPNDEGQLRALIAERALR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttgcggtacatctccacacgcggtggcctgctcgggccgtattccgacaccctgatcgaa
gggctggccccggacggcggtctggtcgtccccgaagagctgccccggctcgacgccgaa
ctgctggaacgatggcggcccctggactatgcggggctcgcgaaagaggtcatcgggctg
ttcgccacgaacatcccccgcgaggagctgtcccgcatctgccgggcggcctaccgtccg
gaggcgttcgcgtcgtcgcagatcgtgccgctgcgggagatcgacggcgggatgacgctg
gtcggcctgtccgaggggccgaccctggcgttcaaggacatggcgatgcggttcctcggc
gagacgctggacgtcgtgctccgcgagtcggaccgcgtcctcaacgtgctcggcgccaca
tccggagacaccggctcggccgcagagcacgcactgcgcgggcgggagcgcttggccgtg
ttcatgctctcgccgctcgggcggatgagcgctttccagcgggcgcagatgtactcgctg
ctcgacgacaacgtccacaatgtcgtggtcgacggtgtcttcgacgactgccagaacctc
gtgaagcggatagcggaagatctggagttcaaacgggtacacagcctcggcgcggtcaac
tcgatcaacttcgggcggatctcggcgcagatcgcctactacgtctgggcatggctgcgg
gcgacggacgcgcggggcccggcggaggtatccttcgccgtcccgtccgggaacttcggc
aacatcctgtccgggcactacgcccgccggatgggactgcccgtgcgcaggctggtgctc
gccaccaacgagaacaatgtgctggacgacttctttcgcacgggccgctaccggccgcgc
agcgccgccgacacactgccgacctccagcccgtcgatggatgtctcgcgcgcctccaac
ctcgaacgcttcgtcttcgatctgatcggccgctcagccgagcgcacggcggccgcctgg
cgcgaactggaggccaccggcgagatcgacctctccgccgaacagcaccgtttcctcccc
gagttcgggatcgtcagcgggacgagcacccacgccgaccgcctggcgaccatccgggcg
gtcgccgagagctccggagtcaccatcgacccgcacacggccgacggtgtgaaggtggcc
cggccgctggtggagccgggggttccgatgctcgtcctcgagacggcgaaaccagaaaag
ttcccggagacgattgcggaggcgctgggtgtggcaccgaccccagacaccgcgacgcgt
gccctgctgaacgcagcccagcgagtgaccgccctccccaatgacgagggacagctgcgg
gcgctcatcgcggagcgcgctttgcgctga

DBGET integrated database retrieval system