KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx15120Help
Entry
Lxx15120          CDS       T00190                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00340  Histidine metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01230  Biosynthesis of amino acids
Module
lxx_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Lxx15120 (hisD)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Lxx15120 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAT89320
UniProt: Q6AE76
Position
complement(1572987..1574297)
Genome map
AA seq 436 aa AA seqDB search
MQTIDLRGVQPTRTAFERLVPRPVVDVQAAMTVAADLIADVRKRGAAALREQAERFDGGV
PASVRVPVAEIVAAVDALPGGVREALEEAIARVREATAAQVPPAAVTRIGPGAVIEQRWQ
PVERAGLYVPGGKAVYPSSVVMNAVPAQVAGVASIALASPPQREFGGAVHPTILGAAGLL
GIDEVYAMGGAGAIGALAWGVGELGLEPVQVITGPGNIYVAAAKRVVRGQTGIDSEAGTT
EILVIADDTADPRYVAADLISQAEHDEAAASLLVTDSPAFVGRVAAELETLAASTRYAER
VRAALGGQQSAVVLVDDLDAAAAFSNAYGPEHLELQTADAEAVLARIQNAGAIFVGPHAP
VSLGDYLAGSNHVLPTGGQARFSPGLGAYSFLRPQQVIRYDREALRAVAGRIVALSGAED
LSAHGEAVTLRFEERA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattgaccttcgcggagtccagcctactcgcactgccttcgagcgcctcgtt
ccccgtccggtggtggatgtgcaggctgcgatgaccgtcgccgccgacctcatcgccgat
gtgcggaagcgcggcgcggcggccctgcgggagcaggccgagcgcttcgacggcggtgtt
cccgcgtccgtgcgggttccggtcgcggagatcgtggccgcggtggacgctcttcccggc
ggggtgcgggaggcgctcgaggaggcgatcgcccgcgtgcgcgaggcgaccgccgcccag
gttccgcctgcggccgtgacccgtatcggacctggcgcggtcatcgagcagcgctggcag
ccggtggagcgcgccggcctctacgtcccgggcggcaaggcggtgtacccgtcgagcgtc
gtcatgaacgcggtcccagcgcaggtcgccggggttgcctccatcgcactcgccagcccg
ccgcagcgcgagttcggcggtgcggtccacccgaccatcctcggagcggccggcctgctc
ggaatcgacgaggtgtacgcgatgggtggcgccggagcgatcggtgcgctggcctggggt
gtgggagagctcgggctcgaaccggtgcaggtgatcaccgggccgggcaacatctatgtc
gccgccgccaagcgcgtcgtgcgggggcagaccggcatcgactccgaagcgggcacgacc
gagatcctcgtgatcgccgacgacacggccgacccgcgctacgtcgccgccgatctgatc
agccaggcggagcacgacgaggccgcggcttccctgctcgtcaccgacagcccggccttc
gtgggccgcgtcgccgccgaactggagacgctcgccgcgtcgacccgctacgccgagcgc
gtgcgtgctgcgctcggcggtcagcagtccgccgtcgtgctcgtggacgatctggacgct
gcggccgcgttcagcaacgcctacggccccgagcacctcgaactccagacggccgatgcg
gaggcagtgctcgcccgcatccagaacgccggcgccatcttcgtggggccgcatgcgccc
gtcagcctcggcgactatctcgccggctccaaccacgtcctgccgaccggcggccaggcc
cgcttctcgccgggcctcggcgcttactccttcctgcgcccgcagcaggtgatccgctac
gaccgggaagcgcttcgcgcggtcgccggccggatcgtcgcgctgtccggcgcggaagac
ctgtcagcgcatggcgaggcggtgaccctgcgcttcgaggagcgggcctga

DBGET integrated database retrieval system