KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx15120Help
Entry
Lxx15120          CDS       T00190                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lxx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lxx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572987..1574297)
Genome map
AA seq 436 aa AA seqDB search
MQTIDLRGVQPTRTAFERLVPRPVVDVQAAMTVAADLIADVRKRGAAALREQAERFDGGV
PASVRVPVAEIVAAVDALPGGVREALEEAIARVREATAAQVPPAAVTRIGPGAVIEQRWQ
PVERAGLYVPGGKAVYPSSVVMNAVPAQVAGVASIALASPPQREFGGAVHPTILGAAGLL
GIDEVYAMGGAGAIGALAWGVGELGLEPVQVITGPGNIYVAAAKRVVRGQTGIDSEAGTT
EILVIADDTADPRYVAADLISQAEHDEAAASLLVTDSPAFVGRVAAELETLAASTRYAER
VRAALGGQQSAVVLVDDLDAAAAFSNAYGPEHLELQTADAEAVLARIQNAGAIFVGPHAP
VSLGDYLAGSNHVLPTGGQARFSPGLGAYSFLRPQQVIRYDREALRAVAGRIVALSGAED
LSAHGEAVTLRFEERA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattgaccttcgcggagtccagcctactcgcactgccttcgagcgcctcgtt
ccccgtccggtggtggatgtgcaggctgcgatgaccgtcgccgccgacctcatcgccgat
gtgcggaagcgcggcgcggcggccctgcgggagcaggccgagcgcttcgacggcggtgtt
cccgcgtccgtgcgggttccggtcgcggagatcgtggccgcggtggacgctcttcccggc
ggggtgcgggaggcgctcgaggaggcgatcgcccgcgtgcgcgaggcgaccgccgcccag
gttccgcctgcggccgtgacccgtatcggacctggcgcggtcatcgagcagcgctggcag
ccggtggagcgcgccggcctctacgtcccgggcggcaaggcggtgtacccgtcgagcgtc
gtcatgaacgcggtcccagcgcaggtcgccggggttgcctccatcgcactcgccagcccg
ccgcagcgcgagttcggcggtgcggtccacccgaccatcctcggagcggccggcctgctc
ggaatcgacgaggtgtacgcgatgggtggcgccggagcgatcggtgcgctggcctggggt
gtgggagagctcgggctcgaaccggtgcaggtgatcaccgggccgggcaacatctatgtc
gccgccgccaagcgcgtcgtgcgggggcagaccggcatcgactccgaagcgggcacgacc
gagatcctcgtgatcgccgacgacacggccgacccgcgctacgtcgccgccgatctgatc
agccaggcggagcacgacgaggccgcggcttccctgctcgtcaccgacagcccggccttc
gtgggccgcgtcgccgccgaactggagacgctcgccgcgtcgacccgctacgccgagcgc
gtgcgtgctgcgctcggcggtcagcagtccgccgtcgtgctcgtggacgatctggacgct
gcggccgcgttcagcaacgcctacggccccgagcacctcgaactccagacggccgatgcg
gaggcagtgctcgcccgcatccagaacgccggcgccatcttcgtggggccgcatgcgccc
gtcagcctcggcgactatctcgccggctccaaccacgtcctgccgaccggcggccaggcc
cgcttctcgccgggcctcggcgcttactccttcctgcgcccgcagcaggtgatccgctac
gaccgggaagcgcttcgcgcggtcgccggccggatcgtcgcgctgtccggcgcggaagac
ctgtcagcgcatggcgaggcggtgaccctgcgcttcgaggagcgggcctga

DBGET integrated database retrieval system