KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx15430Help
Entry
Lxx15430          CDS       T00190                                 

Gene name
glkA
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00010  Glycolysis / Gluconeogenesis
lxx00052  Galactose metabolism
lxx00500  Starch and sucrose metabolism
lxx00520  Amino sugar and nucleotide sugar metabolism
lxx00521  Streptomycin biosynthesis
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
Module
lxx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx15430 (glkA)
   00052 Galactose metabolism
    Lxx15430 (glkA)
   00500 Starch and sucrose metabolism
    Lxx15430 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    Lxx15430 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lxx15430 (glkA)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lxx15430 (glkA)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lxx15430 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AAT89349
UniProt: Q6AE47
Position
complement(1607016..1607879)
Genome map
AA seq 287 aa AA seqDB search
MPTDATRPEEIENAVVAMIQRLSDGPERIVGAGVAAAGFVDAGQSIVYYAPNISWRSEPV
REKLEKRIDLPVIIENDANAAGWAEFRYGAGRLVSDMVILTIGTGVGGAIVSDDRLFRGG
FGAGAEIGHMRVVPGGRPCGCGARGCIEQYGSGRALQRIAGELADAGGIGQALADVRQRK
GSLGGADISELIRAGDAGALAALRQLGDWLGQACASLGAILDPQLFAFGGGVAQAGELLL
EPIRLAYLENLPARGYHPEPEFRIAELVNDAGVVGAADLARLYAASL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgacgccacccggcccgaggagatcgagaacgccgtcgtcgcgatgatccag
cggctgtcggacggaccggagcggatcgtcggcgcgggcgtcgccgccgccggtttcgtc
gacgccgggcagtcgatcgtctactacgcgcccaacatcagctggcgctctgagcccgtc
cgggagaagctcgagaagcgtatcgacctccccgtgatcatcgagaacgatgcgaacgcg
gcgggatgggccgagttccgctacggtgccggccgcctggtgagcgacatggtgattctg
accatcggcaccggggtgggcggtgcgatcgtgagcgacgaccggctcttccgcggcggc
ttcggcgcgggcgccgagatcggccatatgcgcgtcgtcccgggtggccggccctgtggc
tgcggcgcgcgcggctgcatcgagcagtacggttccggccgggctctgcagcggatcgcg
ggcgagctagccgacgccggtggcatcggccaggcgctcgccgatgtccgccagcgcaag
ggctcgctcggcggagcggacatctccgagctgatcagggccggtgacgcgggcgccctc
gcggccctccggcagctgggcgactggctcggccaggcctgcgccagtctcggcgctatc
ctggacccgcagctcttcgccttcggcggcggcgtcgcgcaggcgggagagctgctgctc
gagccgatccggctggcctacctcgagaatctccccgcgcgcggctaccacccggagccc
gagttccgcatcgccgagctcgtcaacgatgccggtgtggtcggcgccgccgacctcgcc
cgcctgtacgccgcctcgctgtga

DBGET integrated database retrieval system