KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx17630Help
Entry
Lxx17630          CDS       T00190                                 

Gene name
gpoA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Lxx17630 (gpoA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lxx17630 (gpoA)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Lxx17630 (gpoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1831110..1831598
Genome map
AA seq 162 aa AA seqDB search
MSLMDIPFRTIDGEPTSLAAFAGKVILVVNVASRCGLAPQYEKLEGLQKTYGDRGFTVIG
FPSNQFLQELNSTDAIKEYCSTTWGVTFPMMEKVKLNGRSAHPLYAELTTYPDAAGKAGK
VKWNFEKFMITPGGAVHRFRPTTEPDAPEIIGLIEQALPTAV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgatggatatcccgttccgcaccatcgacggcgaacccacttccctcgcggct
ttcgcgggcaaggtcatcctcgtcgtcaacgtcgcctcccgctgcgggctcgccccgcag
tacgagaagctcgaaggcttgcagaagacctacggcgaccgcggcttcaccgtgatcgga
ttcccgagcaaccagttcctgcaggagctgaacagcacggacgcgatcaaggaatactgc
tcgaccacctggggcgtcactttcccgatgatggagaaagtgaagctgaacggccgctcg
gcgcacccgctctacgcagagctgaccacctaccccgacgccgctggcaaggcggggaag
gtgaagtggaatttcgagaagttcatgatcacccccggcggcgcggtgcatcggttccgc
ccgacgaccgagccggacgctcccgagatcatcgggctcatcgagcaggcgctgccgacg
gcggtgtga

DBGET integrated database retrieval system