KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx18650Help
Entry
Lxx18650          CDS       T00190                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lxx18650
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lxx18650
Enzymes [BR:lxx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Lxx18650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921433..1922923
Genome map
AA seq 496 aa AA seqDB search
MVVPLPVRSEKSCEAPFVLGGGARISAAGPGADAMARRLRDGLASDGRRELEVVHEPPAF
GEIAIVIAEHEGPEGQREEGHTLEVSAEGVRIGAATATGAFWGVQTLRQLVPTARADDPL
TIEAVRIQDYPRFAYRGAMLDVARHFFPPADIRRFIDAIALLKINHLHLHLTDDQGWRIE
IESWPELTRIAGSTGSDGSPGGYYTQDEYRALVDYAAKRHITIVPEIDVPGHTNAALASY
PELNPDGVAKELYTGRKVGFSSLMTDDATTDRFLRDVVREFAALTPSPYFHIGGDECLST
PAEDFRAFIERAAGLVAETGKTPVGWHEMGRSDRLPRGTIGQYWSFRTPRDKTGEKILSF
VRQGGSVIMSPADVAYLDMVYEKGDAIGLDWANGPTDLRSAYGWEPARVVPGLSESHILG
VEGPLWTETVPTIEDAEEMVFPRLAAVAEIGWSATPYGTDSARDFDDFATRVARLAEQLG
RPRHPVPEGGRPPVAG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcccccttcccgtccggtccgagaaaagctgcgaggccccgttcgtcctcggg
ggcggcgcgcgcatcagcgccgccggtccgggtgcggacgctatggcccggcgcctgcgc
gacgggctggcgagcgacggccgccgcgaactcgaggtggtacacgagccgccggcgttc
ggggaaatcgcgatcgtcatcgcggagcacgaagggccggaggggcagcgcgaggaaggg
cacaccctggaggtctcggcggagggcgtgcgcatcggcgcggccaccgcaaccggggcg
ttctggggcgtgcagacgctccgccagctggtgccgacggcccgcgcggacgacccgctc
acgatcgaggcggtccgcatccaggactacccgcgcttcgcttaccggggcgcgatgctg
gatgtcgcacggcatttcttcccgcccgccgacatccgccgtttcatcgacgcgatcgca
ctgctgaagatcaaccacctccacctgcacctgaccgacgaccagggctggcgcatcgag
atcgagtcctggccggagctgacccggatcgccggctccacgggcagcgacggcagcccc
ggcgggtactacacccaggacgaataccgggcgctggtcgactacgcggccaagcgtcac
atcacgatcgtgcccgagatcgatgtgcccggccacacgaacgcggcgctggcgtcctat
ccagagctgaacccggacggcgtcgccaaagagctgtacacggggaggaaagtcggcttc
agcagtctgatgaccgatgacgccaccaccgaccggttcctgcgggatgtggtgcgcgag
ttcgccgcgctgacgccgagcccgtactttcacatcggcggcgacgaatgcctgagcacc
cctgccgaagacttccgagctttcatcgagcgcgccgccggcctcgtggccgagaccggc
aagaccccggtgggctggcacgagatgggccggagcgaccggctgccacggggcaccatc
gggcagtactggtcgttccgcactccccgcgacaagaccggcgaaaagatcctctccttc
gtgaggcagggcggctccgtcatcatgtcgcccgccgacgtggcctacctcgatatggtc
tacgaaaagggcgacgcgatcggcctggactgggcaaacggaccgaccgacctccgcagc
gcctatggctgggagccggcgcgtgtcgtacccggcctgagcgaatcgcacatcctgggc
gtggagggcccgctctggaccgagaccgtcccgaccatcgaggacgccgaagagatggtg
tttccccggctggccgccgtcgccgagatcggctggtcggccacgccctacggcacggac
tctgcacgcgacttcgacgatttcgccacccgcgtggcccggctcgcggagcagctggga
cgcccacggcacccggtaccggagggtggacggcctcccgtggctggatga

DBGET integrated database retrieval system