KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx19720Help
Entry
Lxx19720          CDS       T00190                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lxx19720 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lxx19720 (sucC)
   00640 Propanoate metabolism
    Lxx19720 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Lxx19720 (sucC)
Enzymes [BR:lxx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lxx19720 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031061..2032224)
Genome map
AA seq 387 aa AA seqDB search
MDLYEYQARDLFEKYGVPVLPGIVADTPEEVRAAAEKLGGVNVVKAQVKTGGRGKVGGVK
VAKNPDEAEEAAKAILGLDIKGHVVRRVMVSGGARIAREFYFSVLLDRANRSYLSLTSVE
GGMEIEQLAVEKPEALARIGVDPIAGVDTTKATEIARAAGFPEELVSKVADVFVKLYDVY
KGEDATLVEVNPLVLTEEGEVIALDGKVTLDENAGFRHPEHEELEDKAAADPLEAKAKEA
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGERHKGVKPANFLDIGGGASAEVMAAGLD
VILNDPQVKSVFVNVFGGITACDAVANGIVKALEILGGDANKPLVVRLDGNNVEEGRRIL
TDANHPLVTLALTMDEGADKAAELAAK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggatctatacgaataccaggccagagacctgtttgagaagtacggggtcccggtcctt
ccgggcatcgtcgcggacactcccgaggaggtccgtgcggccgcggagaagctcggcggg
gtgaacgtggtcaaggcgcaggtgaagactggcggccgcggaaaggtcggcggcgtcaag
gtcgcgaagaaccccgacgaggcggaggaggccgcgaaggccattctgggtctcgacatc
aaggggcacgtcgtgcgccgggtcatggtctccggtggcgctcgcatcgcccgcgagttc
tacttctcggtgctcctcgaccgggccaaccgctcctacctgtcgctcacgagcgtcgag
ggcggcatggagatcgagcagctggcggtcgagaagccggaggcgctcgcgcgcatcggg
gtcgaccccatcgcgggcgtcgacaccacgaaggccaccgagatcgcgagggccgccggg
ttcccggaggagctggtctcgaaggtcgccgacgtcttcgtcaagctctacgacgtctac
aagggcgaggacgcgaccctggtcgaggtcaacccgctggtcctgaccgaggagggcgag
gtgatcgcgctcgacggcaaggtgacgctcgacgagaacgccggattccgtcacccggag
cacgaggagcttgaggacaaggccgcggccgacccgctggaggccaaggccaaggaggcc
gacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgcgggcctc
gtcatgtcgacgctggatgtcgtcgcctacgcgggtgagaggcacaagggcgtcaaaccg
gcgaacttcctcgacatcggcggcggcgcttcggccgaagtgatggcggccgggctggac
gtcattctgaacgatccgcaggtcaagagcgtgttcgtgaacgtcttcggcggcatcacc
gcttgcgacgccgtcgcgaacggcatcgtcaaggcgctggagattctcggcggcgacgcc
aacaagccgctcgtcgtgcgcctggacggcaacaacgtcgaggagggccgccgcatcctg
accgacgcgaaccacccgctggtcaccctcgcactcaccatggacgaaggcgctgacaaa
gccgccgagctggccgcgaagtaa

DBGET integrated database retrieval system