KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx21460Help
Entry
Lxx21460          CDS       T00190                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lxx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2208130..2208666)
Genome map
AA seq 178 aa AA seqDB search
MRPAPRRQRLRVGAPAVLALGGNVGDRVATLRAALDALAAHPGIRVERISPLYETPALKP
DGISGEAPAYLNAVVLIHTVLDPLALLAAVNRIEDGLGRVREERWGDRTVDIDIVDYSGI
VSDDPRVTLPHPRAHERAFVLVPWRDIAPDAVLPSHGRVADLAALATDPVTPFEETAP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccgccccccgccgccagcgcctccgtgtcggagcgcccgccgtgctcgccctg
ggcgggaatgtcggcgaccgcgtcgcgaccctccgcgccgccctcgacgcgctggccgct
catcccggcatccgcgtcgaacggatctcgccgctgtacgagacgcccgcgctcaaaccc
gacggcatttcgggggaggcccctgcgtacctgaacgcggttgtcctcatccacactgtc
ctggacccgctcgccctgctcgccgcggtcaaccgcatcgaagacggcctcggccgcgtg
cgcgaggagcgctggggcgaccgcaccgtcgacatcgatatcgtggactactcgggcatc
gtctccgacgacccgcgggtcacgctcccgcatccccgtgcccacgaacgcgcgttcgtc
ctcgtgccctggcgggacatcgccccggacgccgtgctccccagccacggccgcgtcgca
gacctcgccgccctcgccaccgaccccgtgaccccgttcgaggagaccgcaccgtga

DBGET integrated database retrieval system