KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx21710Help
Entry
Lxx21710          CDS       T00190                                 

Gene name
asn
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lxx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2235523..2237361
Genome map
AA seq 612 aa AA seqDB search
MCGIVGWVSFDRDLTEHRESVDAMTATMACRGPDAEGVWLDRHGALGHRRLAIIDVEGGS
QPMSAHTDDGAVTLTYSGEVYNFSELRGELMRRGHRFETRSDTEVVLHGYLEWDEAVAER
LNGMYAFAIWDARAEKLVMIRDRMGVKPLYFFTTDDGVLFGSEPKAILAHPLADRAVDLD
GLREVVSFAQTPGSAVWCGMREIVPGGVVTVCRAGLREYRYWTLTTRPHTDDLPTTIARV
RSLLEDTVGRQLVSDVPRCTLLSGGLDSSAITAFSAAQLAGHGEKVRSFAVDFVGREDDF
VADDLRSTPDAPYAREVASHVGSQHETIVLDNDAIADPAVRRAVIAARDNPLSLGDLDAS
LYLLFQAIRAHSTVALSGESADEVFGGYRWFHQPEVQAAPTFPWMALPVSGSPTRVRDRF
TAKITAALDLPAYLRERYTSAIAEVQPLENESAHERRMREICYLHLTRLVRMLLDRKDRI
SMAVGLEVRVPFCDHRLVEYVYNVPWAMKTFDGREKSLLRAATADLLPESVLQRTKAPYP
TTSDPGYARTLIQQSRDLLSADDRVFGLVDRGRLEEITRQDPATMTLDVRNGMETALDLS
TWLEIYQPELRM
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtcggctgggtctccttcgatcgggacctgacagagcaccgcgaaagc
gtggacgcgatgacagcgaccatggcttgccgtggacccgacgccgagggggtgtggctc
gacaggcacggcgcgctcggccaccgtcgcctggccatcatcgatgtcgaggggggaagc
cagcccatgtcggcccacacggacgatggcgcggtcaccctcacctacagcggcgaggtc
tacaacttctccgagctccggggggagctgatgcgtcgcgggcaccggttcgagacgcgc
agcgacaccgaagtggtgctgcacggctacttggagtgggatgaggctgtcgccgagcgt
ctgaacggaatgtacgccttcgcgatctgggatgcgcgagcggagaagctcgtcatgatc
cgggaccgaatgggcgtcaagccgctctacttcttcacaaccgatgacggggtgctgttc
ggctctgagccaaaagcgattttggcccacccgctggcggaccgcgccgtcgacctcgac
ggtttgcgtgaggtggtcagcttcgcgcagacaccgggaagcgcggtgtggtgcggaatg
cgtgagatcgtccccggtggggtggtcactgtctgtcgcgccggcctccgggagtatcgc
tactggacgctgaccacccggccgcacaccgatgacctgccgacgaccatcgcgagggtg
cgctcgctgctggaggacaccgtcggccgccagctggtctcagacgtgcctcgctgcacc
ttgctttccgggggattggactcgagcgcgatcaccgcgttttccgcagcccagcttgcc
ggccacggagagaaggtgcggagtttcgcagtcgacttcgtcgggagggaagacgatttc
gtcgcggacgacttgcgctccacaccggacgcaccctacgcacgggaagtcgcttcgcac
gtcggatcgcagcacgagacgatcgtgctcgacaacgatgcgatcgccgatcccgccgtg
cggcgggcggtgatcgctgcgcgcgacaaccctctgagcctgggcgacctggacgcttcg
ctctacctgctgttccaggctatccgcgcacactcgacggtcgccctctccggagagtcc
gccgacgaagtgttcggcggatatcggtggttccatcagcccgaggttcaggccgcaccg
acttttccgtggatggctctccccgtcagcggttcgccgacgcgagtccgagaccgtttc
accgccaagatcaccgccgccctcgacctccccgcttaccttcgcgagcggtacaccagc
gcgatcgccgaggtccagccgctcgagaacgaatccgcccacgagaggcgaatgcgggaa
atctgctacctgcacttgaccaggctcgtccggatgctgctggaccgcaaagatcggatc
agcatggccgtcgggctcgaagtccgcgtccccttctgcgaccaccggctggtggagtac
gtctacaacgttccctgggcgatgaaaaccttcgacggccgggagaagagcctgctgcgc
gccgccaccgccgatctgctgccggagtcggtgctgcagcgcacgaaagctccctacccc
accacttccgatcccggctatgcccgcaccctgattcagcagtcccgggatctcctcagc
gccgacgatcgggtcttcggcctcgtcgaccgggggcggctcgaggagattacgcgacaa
gacccggcgacgatgaccttggatgtgcgcaacggcatggaaacagcgctcgacctcagc
acctggctggagatctaccagcccgaactccggatgtga

DBGET integrated database retrieval system