KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx22610Help
Entry
Lxx22610          CDS       T00190                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lxx22610 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx22610 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Lxx22610 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lxx22610 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lxx22610 (adh)
   00626 Naphthalene degradation
    Lxx22610 (adh)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lxx22610 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2330595..2331647
Genome map
AA seq 350 aa AA seqDB search
MLIERKTPMRAAVVTSFTEPIVVEDVPLPTPGPGQVLVRIETCGLCHTDIHAAHGDWPVR
PSLPFIPGHEGVGRVTALGEGVTAPAVGTRVALAWLGSACGSCRYCETGRENLCVSQQNT
GYSIDGAYAEYAVADARFAVPVPDSVSSMDAAPLTCAGVTAYVAVKTARVRPAERVVVFG
VGGLGHLAVQYARLVGAEVIAVDVTDEKLALATELGADHVVNARTSDPVQEIHALGGADA
VIVLAVAPAVFDQAFRSLSRGGRLILVSLPANGVMGIPVFETVLNGITVAGSIVGTREDL
AEVFRLQALGRTRVIAQPRELEQAPEAMQEVLDGTVPARLVFDLAHVGSH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatcgaaaggaaaactcccatgcgtgcagccgtcgtcacgtccttcaccgagccg
atcgtcgtggaggacgtccccctccccacgccgggacccggccaggtgctcgtgcgtatc
gagacctgcggtctctgccataccgacatccatgccgcccacggggactggccggtgcgc
ccctcgcttccgttcattcccggacacgaaggcgtcggccgcgtcactgccctcggcgag
ggtgtcaccgcgcccgccgtcggaacccgagtggcactcgcgtggctgggaagcgcgtgc
gggtcgtgccgctactgcgagaccggtcgcgagaacctctgtgtctctcagcagaacacc
ggctactccatcgacggggcgtacgcggaatatgcagtcgcggacgcgagattcgccgtg
cccgtacccgattcggtgtcgtcgatggatgccgcgcccctcacgtgcgccggggtcacc
gcatacgtcgccgtcaagacggcacgtgtgcggccggcggaacgggtggtcgtcttcggg
gtgggagggctcgggcatctcgcggtgcagtacgcgcgattggtgggagcggaggtcatc
gccgtagacgtgaccgacgagaagctcgcactcgccaccgagctcggagccgaccacgtc
gtcaacgcccgcacctcggaccccgtgcaggagatccacgccctcggcggtgccgatgcc
gtcatcgttctcgcagtcgcccccgccgtgttcgaccaggcgttccgctccctcagccgg
ggagggcgcctcatcttggtgtcgcttcccgcgaacggagtgatggggatccccgtcttc
gagaccgtgcttaacggcattaccgtggccggttcgatcgtcgggacgcgggaggacctc
gccgaagtcttccgccttcaagcgctcggccggacacgggtcatcgcgcagccccgagaa
ctggagcaagcccccgaagcgatgcaggaagtgctcgacggcaccgtgccggcacgtctg
gtgttcgatctggcgcacgtagggagccactga

DBGET integrated database retrieval system