KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx22675Help
Entry
Lxx22675          CDS       T00190                                 

Gene name
celA
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lxx22675 (celA)
Enzymes [BR:lxx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Lxx22675 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2336505..2338130)
Genome map
AA seq 541 aa AA seqDB search
MNFLRRFAASAAFPIALLSIILAVSPATGADARPFASSEKHSEYGWLHTSGSRILTESGA
PYVIRGIAWFGMETSACAPHGLWTISLDEGMRKIAQLGFNTVRIPYSNECLSGYNTNTIN
GNINPDLVNLTPLQLLDRVVDAAHKARLSVFLDRHRPESAAQSPLWYTSKISEGRWIADW
GALAARYRENRTVIGVDLHNEPHQPACWGCGDPAVDWRLAATRAGNAVLAVNPNLLVIVE
GMEWGGDLTGVASAQVVLNVSNRVVYSPHDYPQEVANHSWFHDPTYPGNLKKVWSSRWGY
IAAQGIAPVLLGEFGTDLQTQSDRLWFKEIVDYLKETGMSFSFWCFNPNSLDTGGIVKSD
WRTPEQEKVDILGPILTPQPEPGGSTPGGSTPGGSTPGGSTPGGSTPGGSTPGGSTPGGS
TPGGSTPGGSPTVKWSLQGAWNTGYVAELQLTADRPVSGWSVSWESPTAVAVSNSWGMRC
GISENRITCSGKDWATNLQPGQTVRVGLQVAAEYAPALPLISVNTDVHRIFKKVFFGCLP
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttgagaagattcgccgcgagtgcggctttcccaattgccttgctgagcatt
attctcgcagtcagccctgcaactggtgctgacgcacgtccctttgcatcgtcggaaaag
cattctgaatatggatggcttcatacctctggctcacgaatccttaccgaatccggcgca
ccctatgtaattaggggtattgcatggtttggtatggaaacttcagcctgcgctccgcat
ggtttgtggactatctcactggatgagggaatgagaaaaatagcccagcttgggtttaat
accgtacgaattccttactcaaatgaatgtttatctggatacaatactaatactattaat
gggaatataaatcctgaccttgtcaatttaactccgctgcagcttttggatcgcgttgtc
gatgctgctcacaaggctcgactcagtgtctttcttgaccgtcatcggccagaatctgcc
gcccagtcaccactctggtacacatccaaaatttctgagggaagatggattgcggactgg
ggggcacttgccgcccgttaccgagaaaaccgcactgttattggtgttgacttgcataac
gaaccacatcagcctgcttgttgggggtgcggagacccagctgtggactggcgtttggcc
gcaacccgggccggaaatgcggtacttgcggtaaacccaaatctgttggtgattgttgag
ggtatggagtggggaggagacttaacaggcgtcgcatccgcacaagttgttcttaacgtg
tcaaaccgtgtggtttattcgccgcatgattatcctcaggaagttgccaaccactcatgg
tttcacgacccaacgtaccctggaaaccttaagaaagtatggagttcccggtggggatat
atagccgctcaaggaattgccccggttctccttggggaattcggaacagatcttcaaacg
cagagtgatcgcctttggtttaaggaaattgttgactatttaaaagagacaggtatgagt
ttctcattctggtgctttaatcctaacagtctcgacactggcggtattgtcaagtccgat
tggcgaacccccgaacaggagaaggttgatattttgggcccaattttaacacctcagcct
gagcccggtggaagcacgcccggtggaagcacgcccggtggaagcacgcccggtggaagc
acgcccggtggaagcacgcccggtggaagcacgcccggtggaagcacgcccggtggaagc
acgcccggtggaagcacgcccggtggaagtcccactgtgaagtggtcattgcagggcgca
tggaacaccgggtatgtcgctgagttgcagctcactgcagatcggcccgtgtctgggtgg
tctgtttcatgggaatccccgacagctgttgcggttagcaatagttggggaatgagatgc
gggatttcagaaaatcggattacctgttccgggaaagactgggcgacgaatttgcaacca
gggcagacagtacgagtcggtcttcaggtagcggcagaatacgctcctgctcttcccctc
atttccgttaacacggatgttcatagaattttcaaaaaagtcttttttgggtgcttgcca
tcataa

DBGET integrated database retrieval system