KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_04720Help
Entry
O159_04720        CDS       T02852                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
lxy00240  Pyrimidine metabolism
lxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    O159_04720
Enzymes [BR:lxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     O159_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-GeneID: 17047573
NCBI-ProteinID: AGW40668
UniProt: U3PAY0
Position
438251..439549
Genome map
AA seq 432 aa AA seqDB search
MVEAFDAVDLIRTKRDRGELRTAEIDWLVDAYTRGYVGDEQMSAMAMAIFLNGMTRREIK
DLTLAMIASGERMDFSGLGKPTADKHSTGGVGDKITLPLMPLVAAFGVAVPQLSGRGLGH
TGGTLDKLESIPGWRADLSNEEMFAQLRNEGGVICAAGSGLAPADGKLYALRDITGTVEA
IPLIASSIMSKKIAEGTGALVLDVKFGSGAFLKDIEKSRELARTMVELGTDAGVATSALL
TDMNVPLGLAIGNANEVRESVEVLAGGGPADVVELTVALAREMLALAGQPDAEVEAALRD
GRAMDKWREVIRAQGGDPEAALPVARETHTVLAGEDGILIEQQALPFGIAAWRLGAGRAR
KQDPVQPAAGIDLHAKPGDEIRAGQPLFTLSADEPARFERALEALDGAYRIAPAGTPFER
GPIVAERIGRSR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaggcgttcgacgccgtcgacctgatcaggaccaagcgcgaccgcggagagctc
cgcaccgccgagatcgactggctggtggacgcctacacccgcggctacgtgggcgacgag
cagatgtccgcgatggcgatggcgatcttcctcaacggcatgacccgccgcgagatcaag
gacctcacgctcgccatgatcgcctcgggcgagcgcatggacttctccggtctcggcaag
cccaccgcggacaaacactccaccggcggtgtcggcgacaagatcacactgccgctcatg
ccactggtcgccgccttcggcgtggccgtcccgcagctctccggccgcggtctcgggcac
accggagggacgctcgacaagctcgagagcatcccgggctggcgcgccgacttgtcgaac
gaggagatgttcgcgcagctgcggaacgagggcggcgtcatctgcgcggccggttcgggg
ctcgccccggccgacggcaaactgtacgcgctgcgggacatcacgggcacggtcgaggcc
atcccgctgatcgcctcctcgatcatgtccaagaagatcgcggagggcaccggcgcgctg
gtgctcgacgtgaagttcggttcgggagcgttcctcaaagacatcgagaagtcgcgcgag
ctggctcggacgatggtcgagctgggcacggacgccggggtcgccacctcggcgctgctc
acggacatgaatgtcccgctgggcctcgccatcggcaacgccaatgaggtgcgcgagtcc
gtcgaggtgctcgccggcggcggtcccgccgatgtcgtggagctgacggtcgcgctcgcg
cgcgagatgctcgcgctggccggtcagccggacgcggaggtcgaggcggcgctgagggac
gggcgggcgatggacaagtggcgggaggtcatccgcgcccagggcggcgacccggaggcg
gcgcttccggtggcgagggagacgcacaccgtgctcgccggggaggacggcatcctgatc
gagcagcaggccctccccttcggcatcgccgcatggcgcctgggcgctggccgcgcccgc
aagcaggacccggtgcagcccgcggcgggcatcgacctgcacgcgaaaccgggcgatgag
atccgcgccggccagccgctgttcaccctctccgccgacgagccggcgcgcttcgagcgc
gcgctcgaagcgctcgacggcgcctatcggatcgcccccgccggaacgccgttcgagcgc
gggccgatcgtcgcggagcggatcggccgctcccggtag

DBGET integrated database retrieval system