KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_10580Help
Entry
O159_10580        CDS       T02852                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O159_10580
Enzymes [BR:lxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     O159_10580
Exosome [BR:lxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O159_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995522..997723)
Genome map
AA seq 733 aa AA seqDB search
MTRLPEGAAALPGLDDAVLHAVATGSYHDAHSVLGQHPVTAAGSAETVTVIRALRPLAEA
VFAVLPTGAHLELAHLAHGIWQGVSIVGPGSYEIEARYADGTVWSADDPYRFLPTIGEID
LHLIREGRHEQLWTALGARVRDLGGVTGTAFTVWAPHARAVRVVGDFNGWDGTLHALRNM
GSSGVWELFVPGLGEGAIYKFDLLAQSGEWMRKIDPMARLAETPPDTASRITVSRHEWQD
GEWMRRRAASDPHAGPMSIYELHFGSWRPGLGYREAADQLIDYLGALGYTHVEFLPLAEH
PFGGSWGYQVTGYYAPTSRFGSPDDLKYLIDRLHRAGIGVLLDWVPGHFPKDDWALARFD
GQPLYEHADPRRGEHADWGTYIFDYGNSQVRNFLVANALYWLEEFHIDGLRVDAVASMLY
LDYSRDDGEWEPNIHGGRENLEAIAFLQEVTATAYKRNPGTIVIAEESTSYPGVTAPTSS
GGLGFGLKWNMGWMHDSLEYIREDPLYRRWHHSRITFSFVYAWSESFLLPISHDEVVHGK
GSLLGKMPGDHWQQLANMRAYLAFMWAHPGKQLLFMGQEFGQPSEWSEERGLDWWILDQP
THRGLWNLVCELNAVYRGTPALWAHDNDPSGFEWLDGSDAAGNVLAFLRKDGRGEPIAVI
LNFSGAPHPEYRVGLPFAGDWEEALNTDADVFGGSGVGNFGGVSAEDEPWMGRPASAVLT
LPPLGALFLKPRR
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctccccgagggagccgccgccctgcccgggctcgacgacgccgtgctgcac
gccgtcgccaccggcagctatcacgatgcacactccgtgctcggccagcacccggtgacc
gcggccgggagcgccgagacggtcacggtcatccgcgccctgcgcccactggccgaagcc
gtgttcgccgtgctgccgaccggggcgcacctcgagctggcgcacctcgcacacgggatc
tggcagggtgtgagcatcgtcggcccgggttcgtacgagatcgaggcccgctacgccgac
ggcactgtctggtccgccgacgacccctaccgcttcctgccgaccatcggcgagatcgac
ctccacctcatccgcgagggccgccacgagcagctctggacggcgctcggggcccgggtg
cgcgacctcggcggcgtcacgggcacggctttcaccgtgtgggcgccgcacgctcgggcc
gtccgtgtcgtcggagacttcaacggctgggacggaacgctgcacgccctgcgcaacatg
ggctcctccggagtgtgggagctgttcgtccccgggctcggcgaaggcgcgatctacaag
ttcgacctgctcgcgcagtccggcgagtggatgcgcaagatcgacccgatggcgcggctg
gccgagaccccgccggacacggcctcccgcatcaccgtcagccggcacgagtggcaggac
ggcgagtggatgcgccgccgcgcggccagcgacccgcacgccggtccgatgtcgatctac
gagctccacttcggcagctggcgtccgggcctcggctaccgcgaggcggccgaccagctc
atcgactacctcggcgccctcggctacacgcatgtcgagttcctgccgctcgccgagcat
cccttcggcggctcctggggataccaggtcaccggatactacgcgccgacgagccgcttc
gggagccccgacgatctcaaatacctcatcgaccgcctgcaccgcgcgggaatcggggtg
ctgctcgactgggtccccggccacttccccaaagacgactgggcgctcgcccgcttcgac
ggccagccgctctacgagcacgccgacccgcgccgcggcgagcacgccgactggggcacc
tacatcttcgactacggcaactcgcaggtgcggaacttcctcgtggccaacgcgctctac
tggctcgaggagttccacatcgacggtctgcgggtggatgccgtcgcgtcgatgctctac
ctcgactactcgcgggacgatggcgaatgggagcccaatatccacggcgggcgggagaat
ctcgaggcgatcgccttcctgcaggaggtcaccgcgaccgcctacaagcggaaccccggg
acgatcgtgatcgcagaggagtccacgagctaccccggcgtcacagctcccacctcctcc
ggcggcctgggcttcggcctcaagtggaacatggggtggatgcacgactcgctggagtac
atccgcgaggaccccctgtatcgccgctggcaccacagcaggatcacattctcgttcgtg
tacgcgtggagcgagagtttcctcctgccgatcagccacgacgaagtcgttcacgggaag
gggtcactcctcggcaagatgccgggcgaccactggcagcagctcgcgaacatgcgcgcc
tacctcgcgttcatgtgggcgcacccgggcaagcagctgctcttcatgggccaggagttc
ggccagccctccgagtggagcgaggagcgcggcctcgactggtggatactcgatcagccc
acccaccgtggcctgtggaacctcgtctgcgagctgaacgccgtctaccgcggcaccccc
gcgctctgggcacacgacaacgacccctccggtttcgaatggctggacggatcggacgcg
gccggcaacgtcctggctttcctgcgcaaggatgggcgcggggagcccatcgcggtcatc
ctgaacttctcgggcgccccgcacccggagtaccgggtgggactgcccttcgctggcgac
tgggaggaggcgctcaacacggacgcggacgtgttcggcggctccggagtcggcaatttc
ggcggggtgagcgcagaggacgagccgtggatgggacgtccggcctcggcggtgctgaca
ctgccaccgctcggagcgctcttcctcaagccccggcgctga

DBGET integrated database retrieval system