KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_14720Help
Entry
O159_14720        CDS       T02852                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lxy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:lxy00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lxy00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:lxy00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lxy00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405366..1406721
Genome map
AA seq 451 aa AA seqDB search
MTETLSAPGHSVAQERRIVTAIPGPKSQELHQRRLAVVPTGVSSALPVYIARANGAVLVD
VDGNQFVDFGAGIGVTTIGHTDSAVVAAATEQVREVIHTLFTITPYEEYVRVAELLAVYT
PGDHAKKTVLVNSGAEAVENGVKIARKHTGRRAVAVLDHAYHGRTNLTMAMNYKAMPYAS
GFGPLAGDVYHAPGSYPYRDGLSGAEAASRTIAYLEKVVSASDLACLVAEPIQGEGGFMV
PADGYLPALQSWCAANGVVFVADEIQSGMARTGAYYASEHFGLVPDLVLSAKGIAGGLPL
AAVTGRADIMDSAQPGGLGGTFGGNPVAAAAAIAVFDQIEKNGLLAEGKRIENALKPALT
ALQAKHDIIGEVRGIGAMIAIELVKPGTAQTTKEPNPEAVTAVVAYAAQHGILFLTAGTW
GNVLRFLPSLAVSDELIADAVSVIDDALATL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaccctgagcgcgcccggccactccgtggcgcaagaacgccgcatcgtcacc
gccatccccggccccaagtcgcaagagttgcaccagcgccgtctcgcggtggtgccgacc
ggtgtctcctcggcgctcccggtgtacatcgcccgcgcgaacggcgcggtcctggtggat
gtcgacggcaaccagttcgtcgacttcggcgccggcatcggcgtgaccacgatcggtcac
accgacagcgcggtcgtcgctgccgccaccgagcaggtgcgggaggtcatccacacgctc
ttcacgatcacgccctacgaggagtacgtgcgtgtcgcggagctgctcgccgtgtacacc
cccggcgaccacgccaagaagacggtgctcgtcaactccggcgcggaagccgtcgagaac
ggcgtcaagatcgcccgcaagcacaccggccgccgcgccgtcgccgtgctcgaccacgct
taccacggccggacgaacctgaccatggcgatgaactacaaggccatgccgtacgcgagc
ggcttcgggccgctcgccggcgacgtctaccacgctccgggctcctacccctaccgcgac
ggcctcagcggcgccgaggcggcctcgcggacgatcgcctatctcgagaaggtcgtcagc
gcgagcgacctggcctgtctcgtcgccgagccgatccagggcgaaggcggcttcatggtg
ccggccgacggctacctgccggccctccaaagctggtgcgccgcgaacggcgtggtgttc
gtcgccgatgagatccagagcgggatggcgcgcaccggcgcctactacgccagcgagcac
ttcgggctcgtccccgacctggtgctgagcgccaaaggcatcgcgggcggtctgccgctg
gccgctgtgaccggccgcgccgacatcatggactccgcacagccgggaggcctcggcggc
accttcggcggcaacccggtcgccgcggccgcggcgatcgccgtcttcgaccagatcgag
aagaacggcctcctcgcggagggcaagcgcatcgagaacgccctgaagccggcgctcacg
gcgctgcaggcgaagcacgacatcatcggcgaggtgcgcggcatcggcgcgatgatcgcg
atcgagctggtcaaaccgggcacggcgcagaccacgaaggagccgaacccggaggcggtc
accgcagtggtcgcctacgcggcgcagcacgggatcttgttcctcaccgccggcacctgg
ggcaacgtgctccggttcctgccgagcctcgccgtctcggacgagctcatcgcggacgcc
gtctccgtgatcgacgacgccctcgcgacgctgtga

DBGET integrated database retrieval system