KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_23830Help
Entry
O159_23830        CDS       T02852                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lxy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224239..2224913)
Genome map
AA seq 224 aa AA seqDB search
MAKLYFRYGAMNSGKSTAMLQAAYNYEERGHRVLLAKPSIDTKGDRGILSRLGVTRQVDY
LIAPGTDAYGVFQQHRDRIRKRFDRDISAVLVDEAQFLTEAQVDDLLRIALLDDVPVLAY
GIRTDFQTVAFPGSRRLLEVAHSLEELKTICRCGRKAIFNARKIDSVFVFDGDQVAIDGA
SVSYESLCGACYLQESRGVLNNGRRRWPVDVATAYDSEPDPDFT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaactgtatttccgctacggcgcgatgaacagcggcaagagcaccgccatgctc
caggcggcatacaactacgaggagcgcggacaccgcgtgcttctggcaaagccgtcgatc
gacaccaaaggcgacagaggcatcctgtcgcgcctgggcgtgacccgccaggtggactat
ctgatcgcgccggggacggacgcgtacggcgtctttcagcagcaccgcgaccgcatccgc
aaacggttcgatcgcgatatcagcgccgtgctcgtcgacgaggcgcagttcctcaccgag
gcgcaggtcgacgatctgctcaggatcgcgcttctggacgatgtcccggttctcgcctac
ggcatccgcaccgatttccagaccgtcgctttcccgggcagccgccgtcttctcgaggtc
gcgcacagcctcgaggagctgaaaacgatctgtcgctgcgggcgcaaggcgatcttcaac
gcgcgcaaaatcgacagcgtcttcgtcttcgacggcgatcaggtcgccatcgacggcgcc
tcggtgagctacgaatcgctctgtggagcctgctatctgcaggagagccgcggtgtgctg
aacaatggccgccggcgctggcctgtcgatgtcgcgacagcctacgatagcgaacccgac
cccgatttcacctga

DBGET integrated database retrieval system