KEGG   Mycoplasma agalactiae PG2: MAG_1230Help
Entry
MAG_1230          CDS       T00536                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAG_1230
Enzymes [BR:maa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MAG_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136795..139182
Genome map
AA seq 795 aa AA seqDB search
MKKSHDFDSKEYLNLVDAWWRAANYLSVGQMYLRNNPLLKIPLTSNDVKIYPIGHWGTVP
GQNFIYAHLNRIINKYDLNMFFISGPGHGGQVIASNTYLDGSYTELFPHVTKDIKGMTHL
FKYFSFPGGTASHAAPECPGSIHEGGELGYSLSHAAGAVLDNPDVIAATVIGDGESETGP
LSAGWFINSFINPANDGAVLPILHVNGGKISNPTIWSRRSNEELVSYFTGAGWKPFIVEG
NEPEYMHHEMAKALDASVELIKQYQAEARKNGANKAKRPQWPMIVLKSPKGWTGPKEWNH
EAIEGSFRAHQVPVPVSAEKMQHIDALENWLRSYRPEELFDENAQLKPEIAAIAPKGDRR
MGKNPIANGGINPRAINVGDWTKFALDIKQPGKVINQDMVTLGSYLGELSLLNKDNFRVW
GPDEHKSNRLYEMFKVTDRQWLDRIDEKYDEFLSSVGRIIDSQLSEHQAEGMLEGYVLTG
RHGVFASYESFLRVVDSMLTQHMKWVKKALDIPWRNDYPSLNVIATSNAFQQDHNGYTHQ
DPGLIGHLADKRPELIREYLPADTNTLLATMAKALQDRNVINLIISSKQPRHQFFSIEEA
TELVEKGIKIIDWASNIKPNEEPDLVVAASGTESTIESLATITYLRAHFPELKIRFVNVL
DLLKLRHPSIDPRGLSDSEFDSIFTKDKPILFAFHGYEAILRDIFFLRSNHNIITHGYRE
NGDITTAFDIRLLSEMDRFHMTANVAKKLAPVVGESKANELVKLMEDKIKEHRAYIKEYG
TDLPEVKEWEWTPYK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtcacacgattttgacagtaaggaatatctaaatttagttgacgcctgatga
agagctgctaactatttatcagttggtcaaatgtatttaagaaataatccacttttaaaa
ataccacttaccagtaatgatgtaaaaatttacccaattggtcactgaggaacagttcct
ggtcaaaactttatttatgcacacttaaacagaatcataaacaaatacgaccttaatatg
tttttcattagtggtccaggccatggcggtcaagttatagcttcaaacacatatcttgat
ggctcatatactgaattatttcctcatgttactaaagacatcaaaggaatgacacactta
tttaaatacttctcattccctggtggaacagctagtcacgctgctcctgaatgtcctggt
tctattcatgaaggtggtgaattaggatattcattatcacatgcagcgggtgcagtttta
gataaccctgatgttattgctgctactgttattggtgacggtgaatcagaaactggtcct
ctttcagctggttgatttataaattcatttattaaccctgctaatgatggagcggtattg
cctatcttgcacgtaaatggcggaaaaatttcaaacccaacaatttgatcgcgtagatca
aatgaagaattagtttcatatttcacaggcgctggttgaaaaccatttattgttgaaggc
aatgaacctgaatatatgcaccatgaaatggccaaagcacttgatgcaagtgtggaatta
attaaacaatatcaagctgaagctaggaaaaatggcgccaataaagctaaaaggccacag
tgaccaatgattgttcttaagtcaccaaaaggatgaactggacctaaagaatgaaatcat
gaagcaattgaaggaagtttcagagcacaccaagttccagttcctgtatcagctgaaaag
atgcaacacattgatgcgcttgaaaactgattaagatcatatagaccagaagaattattt
gacgaaaatgcccaattgaagcctgaaatagctgctattgcaccaaaaggtgacagaaga
atgggcaaaaaccctattgctaatggcggcattaatcctagagccataaatgttggagat
tgaacaaaatttgcactagatattaaacaacctggcaaagttattaaccaagatatggtt
actttaggttcatatttaggtgaattaagtctactaaacaaagataatttcagagtttga
ggacctgatgaacataagtcaaacagactatatgaaatgtttaaagtaactgaccgtcaa
tgattagacagaattgatgaaaaatatgatgaatttttatcatctgtaggtagaattatt
gactcgcagctatctgaacaccaagctgaaggtatgcttgaaggatatgtgctaacagga
agacatggtgtttttgcttcatatgaatcatttttaagagtagttgattctatgcttact
caacacatgaaatgagttaaaaaagcactagacattccttgaagaaatgattatccttca
cttaatgttatagcaacctcaaacgctttccaacaagatcataatggttatactcaccaa
gatccaggattaattggacacttagctgacaaaagacctgaattaattagagaatacctt
ccagctgatacaaacacattgcttgcaacaatggctaaagcattgcaagacagaaatgtt
attaacttaattatttcatcaaaacaacctagacatcaattctttagcattgaagaagct
actgaattagttgaaaaaggtataaaaatcattgattgagcatcaaatattaagccaaac
gaagaacctgatttagttgttgctgcatcaggaaccgaatcaacaattgaatcattagca
acaattacataccttcgtgctcatttccctgaattaaaaattagatttgttaatgtactt
gacttactaaaactaagacatccaagcattgaccctagaggattaagcgattctgaattc
gactcaatctttacaaaagataagcctattttatttgccttccacggttatgaagcaatc
ttaagagatatattcttcttgcgttcgaatcacaacattattactcacggttatagagaa
aatggcgatataacaacagcatttgacattcgtttacttagcgaaatggacagattccat
atgacagctaatgttgctaaaaaattagcaccagttgttggagaatctaaagcaaatgaa
ttagtaaaactaatggaagataaaattaaagaacatagagcatatattaaagaatacggt
actgacttgccagaagttaaagagtgagaatgaacaccatataaataa

DBGET integrated database retrieval system