KEGG   Mycoplasma agalactiae PG2: MAG_2150Help
Entry
MAG_2150          CDS       T00536                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:maa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAG_2150
Enzymes [BR:maa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MAG_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(246389..247777)
Genome map
AA seq 462 aa AA seqDB search
MTIASFLANKNRVKKIRYSKFKQYIKEIQKESAKEADIDNFKYDESQINALRKFIDNKFV
VITGGPGTGKTTLIKGIVKLFKKVYPNESFKIATPTGRAAARIKESFEESDATTIHKLLQ
YDPSTDKFRKNMFNPLDDGLLIIDETSMVDNNLFSSFISSIGNAKRIVFVGDVEQLPSIG
IGNAFEDIIKSKKITTVELKSTHRQQDQSKITDLAYMIRNNNFDITKLQETAEKSDLKTI
FIDDQSKYLEEIINNYNFRNKNGFYIPNQIQIISPFNKGALGIEEINRKIQEKFNRNKNK
DEDEKLNANGYSFYKEDKIMYLKNQNDLSNGDIGVVDIINKDNKQMTATFNNDNKKVELY
SSDLTNLALCYACTVHKTQGSEFQKVILVLDPEKGNSFINKKLVYTAITRAKDELVIITS
RQYFNKSVNQRPAQRDTSLAKHIKIMHWKKKWSLFRKRQYCH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgactattgcttcatttttagctaataaaaacagagtcaaaaaaattaggtattccaaa
tttaaacaatatataaaagaaattcaaaaagagtctgcaaaagaagcagacatagacaac
tttaaatatgatgaaagtcaaattaacgcactaagaaagtttattgataataaatttgta
gtaattactggtggccctggaactggtaagaccactttaataaaaggcatagtaaaacta
tttaaaaaagtttatccaaatgaaagttttaaaatagcaactccgacaggaagagcagca
gcaagaattaaggaaagttttgaagaatccgacgctacaactattcataaattactgcaa
tatgatccttcaactgataagtttagaaaaaatatgtttaatccgctagatgatggttta
ttaattattgatgaaacatcaatggttgacaacaatttatttagtagctttatttcatct
attggaaatgcaaaaagaatcgtttttgttggcgatgtggaacagttgccaagcattgga
attggtaatgcgtttgaagatattattaaatctaaaaaaataacaactgtcgaattaaaa
agtacacaccgacaacaagaccaaagcaaaattactgatctagcttatatgatcagaaat
aataattttgacatcacaaagcttcaagaaacagcagaaaaaagcgatttgaaaactatt
tttattgatgatcaaagtaaatacttagaggagattatcaataattataattttcgtaat
aagaatggtttttatattccaaatcaaattcaaattatttctcccttcaacaaaggagca
ttaggaatagaggaaataaatagaaagatccaagagaaatttaatagaaataaaaacaaa
gacgaagacgaaaaattaaatgcaaatggttacagcttttataaagaagataaaataatg
tatctaaaaaatcaaaatgatttatctaatggcgatattggagttgtcgatattataaat
aaagacaacaaacaaatgactgcaacttttaataatgataataaaaaagttgaattatat
agctcggatctaactaatttagctttgtgttatgcttgtacagttcataaaactcaaggc
agcgaatttcaaaaagtgattttagtgttagacccagaaaaaggtaattcctttattaat
aaaaagttagtctatacagctataactagggctaaagatgaactagttattattaccagc
agacaatattttaataaaagtgttaatcaaagacctgctcaaagagatacaagtttagct
aaacatataaaaataatgcattggaaaaagaaatgaagtctttttagaaaaagacaatat
tgtcactaa

DBGET integrated database retrieval system