KEGG   Mycoplasma agalactiae PG2: MAG_2230Help
Entry
MAG_2230          CDS       T00536                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:maa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259751..260347
Genome map
AA seq 198 aa AA seqDB search
MILYRIGEIIHKHNSNIIFESQGIGYSLILPDPERVEIKQKCKLYLFEIKNEYQYATYAF
KDFKERLLFVDLISLNGIGPRAAFNILNFGFEKVVALIAEGNAEALIEIPYLNPRMARLI
VAELQAKWSKMISPKDAAKINETTNTLSEVKETLKMVGFKTKQIDGALSKISSTDDVEKM
IEEAIKLMSTQNYESATA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatagaataggtgaaattatccataaacataactcaaacataatatttgaa
agtcaaggaataggatattcattaatacttcctgatcctgagcgagttgaaataaagcaa
aaatgtaaattatatttatttgaaatcaaaaacgaatatcaatatgctacttatgcattt
aaagatttcaaagaaagactgctttttgtagatttaatctctcttaatggcattgggcca
agagcagcttttaatatattaaactttggcttcgaaaaagttgtggcattaattgctgaa
ggaaatgcagaagcactaattgaaattccatatcttaatccaagaatggcaagactgatt
gtggctgaattacaggcaaaatggtcaaaaatgattagtccaaaagatgcagcaaaaatt
aatgaaacaactaatactttatctgaagtaaaagaaactcttaagatggtaggctttaaa
acaaaacaaattgatggcgcactttctaaaatttcatcaactgatgatgttgaaaaaatg
attgaagaagcaataaaattaatgtctactcaaaactatgaatcagctactgcttag

DBGET integrated database retrieval system