KEGG   Mycoplasma agalactiae PG2: MAG_2740Help
Entry
MAG_2740          CDS       T00536                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:maa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAG_2740
Enzymes [BR:maa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MAG_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321091..322137
Genome map
AA seq 348 aa AA seqDB search
MKALVYHGDHKIALETVDRPIIQKPTDAIVKVTKTTICGTDLGIYKGKNPEVADGRILGH
EGIGIVEEVGSSVSNVKVGDKVLIGCVTPCGKCDNCRKQLYSHCREAEGGWKFGYMINGT
QAEYVRVPFADNSLYKYPESISDEVAVMLSDALPTGHEIGVQYGAVAPGKSVAIVGAGPV
GMGALLTAQLYSPAHLIVIDFDKNRLEMAKKLGATHTLVPDESLLTKLQEIVGQDGVDVA
IEAVGVPSSWDTCQKIVKASGNISVVGVHGKKVDFNVQDLWIKNITVTTGLVNTNTLPML
INAVSTGKLPVQGLITHRFNLSDIMSAYDTFLNASDNKAMKIFIDATK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttagtttatcatggcgatcacaagattgccttagaaactgttgataggcca
attattcaaaagccaacagatgcaatagtgaaagtgactaaaacaactatttgtggtaca
gacttaggtatttataaaggtaaaaatcctgaagttgctgacggtagaattttaggtcat
gaaggcattggaattgttgaagaagtaggttcaagcgtttcaaatgttaaagtaggagac
aaagttttaattggttgtgttacaccttgcggtaaatgtgacaattgtagaaaacaatta
tactcacactgtagagaagctgaaggtggttgaaaattcggttatatgattaatggaaca
caggctgaatatgtaagagttccatttgctgataatagtttatataaatatcctgaatca
atttctgatgaagtggctgttatgttatctgacgcacttccaacaggtcatgaaattggc
gtgcaatatggcgctgttgctcctggtaaatcagtagcaattgttggagctggaccagtt
ggtatgggggcattattaacagctcagttatattcaccagcacacttaattgtgatcgat
tttgacaaaaaccgtttagaaatggctaaaaaattaggcgcaactcacactttagtgcct
gatgaatcattattaactaaattacaagaaattgtcggccaagatggcgttgacgttgct
attgaagcagttggtgtgccttcatcatgagacacatgtcaaaaaattgttaaagccagc
ggaaatatttcagttgttggagttcatggcaaaaaagttgacttcaatgttcaagattta
tgaattaaaaacattacagttacaaccggattagtaaacacaaacacacttccaatgcta
attaatgcagtttcaacaggaaaactacctgtgcaaggattaattactcacagatttaac
ttatctgatattatgagtgcatatgacactttcttaaatgcatctgataacaaggcaatg
aagattttcattgacgcaacaaaataa

DBGET integrated database retrieval system