KEGG   Mycoplasma agalactiae PG2: MAG_3150Help
Entry
MAG_3150          CDS       T00536                                 

Gene name
mutM
Definition
foramidopyrimidine DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:maa03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(376847..377686)
Genome map
AA seq 279 aa AA seqDB search
MPELPEVKTVVKALKGNILNLTITNVIVKLDKLIKNATASEFKNYLLNEKILDVYNVGKN
IIYKLSNNKNLVSHLRMTGKYFTDSSINRTRKHDYIIFELDSQMFLFYNDSRQFGTFHIK
NDNELFSSKPLDKLGKEVDKIDPKNLYESVRNKSIPIKSFLLDQSYILGIGNIYANEILF
LSKINPWTKTNKIPYEKFKEILSNTKIILDKATELGGSTIVDFSGLNGAEGQFQNHLQVH
MRANMPCNKCNALIQQEFIAQRMTYYCPICQKENYEQEK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgccagaagttaagacagtagttaaagcacttaaaggtaatattttaaat
ttaactatcactaatgtcattgtcaagcttgataagctaattaaaaatgctactgctagt
gagtttaaaaactacttgttaaatgaaaaaatacttgatgtttacaatgttggtaaaaac
attatttacaaactttcaaataataaaaatttagtaagccacttacggatgacgggcaaa
tattttactgatagcagcataaatagaacaagaaaacatgactatattatttttgagtta
gatagccaaatgtttctgttttataatgattctcgtcagtttggaacttttcatattaaa
aatgataatgagctattttcatctaaacctcttgataaattaggcaaagaagttgacaaa
attgatcctaaaaatttatatgaatcagtcagaaacaaaagtattcctattaaatcattt
ttgctagatcaaagctatattttaggcataggaaatatttatgctaatgaaatattattt
ttatcaaaaataaacccttgaactaaaactaataaaataccttatgaaaagtttaaagaa
atattaagcaacactaaaataattttagataaagcaactgagctaggcggctcaacaatt
gttgatttttcaggccttaatggtgctgaaggtcagttccaaaatcatttacaagttcat
atgcgcgcaaacatgccttgcaataagtgcaatgcattaatacagcaagaatttattgca
caaagaatgacttattattgccctatttgtcaaaaggaaaattatgagcaagaaaaataa

DBGET integrated database retrieval system