KEGG   Mycoplasma agalactiae PG2: MAG_4280Help
Entry
MAG_4280          CDS       T00536                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:maa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:maa00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:maa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:maa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501297..502337)
Genome map
AA seq 346 aa AA seqDB search
MKAFVVKAPKEYSVELIDIPEPVDNEVLVKLETSGVCHTDLHIANFDWPRQPNYPMVPGH
EGIGIVTKVGPKCSKIKVGDRVGIGYMFSACGQCEYCISGKEILCTSRVVTSLVKPGTFA
EYTIGHEDYVLPIPSNLDIVAGAPILCGGVTSYKALKQAELKVGDYVAIIGIGGLGHFAI
AYAKAMGLNIIAIDIDDKKLESAKTEGAHHTFNANDLSLVQEIKEITNGGVHAVINTSVS
AASAVLAMYILRRAGKQVLVGVPPKDENGKIEFPLSILATISGENHILGSVVGTRQDTKE
ALILGTKGIVSKVGQVINLDEVKDVFEKLSKGELIGRAVIDFRSYK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttgtggtgaaagcccctaaagaatatagtgttgaattaattgatatacca
gaaccagttgataatgaggttttagttaaattagaaactagtggtgtgtgtcacacagat
ttgcatatagcaaattttgattgacctagacaaccaaattatccaatggtgccaggtcat
gaaggcataggaattgttacaaaagttgggccaaaatgcagcaaaataaaagttggcgac
agagttggcattggatatatgtttagtgcatgtggtcagtgcgaatattgcataagtgga
aaagaaattttatgtacttctagagttgtaacttctttagttaagccaggaacttttgct
gaatatacaattggacatgaagattatgttttgcctataccaagtaatttagatattgtt
gcaggagcgccaatattatgtggcggagtaactagttataaagcactaaagcaagctgaa
ttaaaagttggtgattatgttgctattattggaattggtggactaggtcattttgcaata
gcatatgctaaagctatggggctaaatattattgctatagatattgacgataagaaatta
gaatcagctaaaactgaaggagcgcaccatacatttaatgctaatgatttatcattagtt
caagaaattaaagaaattactaatggcggtgtgcatgctgtaattaatacatcagtttct
gccgcttcagcagtcttagcaatgtatattttacgtagagcaggcaagcaagtattagtt
ggtgttccaccaaaagatgaaaatggaaaaatagaatttcctttgtcaattttagccaca
atttcaggcgaaaatcatattcttggttctgttgttggcacaaggcaagatactaaagaa
gcactaattttaggtacaaaaggcatagtatctaaagttgggcaggtaattaacttagat
gaagtaaaagatgtgtttgaaaagctatctaaaggtgagttaatcggcagagctgtaatt
gactttagaagctataaataa

DBGET integrated database retrieval system