KEGG   Mycoplasma agalactiae PG2: MAG_4470Help
Entry
MAG_4470          CDS       T00536                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MAG_4470 (glpK)
Enzymes [BR:maa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MAG_4470 (glpK)
Exosome [BR:maa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAG_4470 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521993..523501
Genome map
AA seq 502 aa AA seqDB search
MEKYILTLDEGTTSARALIVNKKGEIIAVEQAEFTQHFPKEGWVEHDAIEIWNTQRSTLV
QVLNKSKISPEQIDSIGITNQRETVVIWNKETGLPIYNAIVWQDQRTAEYCQSFTKEQVE
LVKEKTGLIINPYFSGTKVKWILDNVPNVRELASEGKLMFGTINTWLIYRLTGGKVFATD
HTNAQRTLLYNIHTNNWDDELLKLFDIPKSILPEIKSCSEEYGLTFPHLFSRDNESQIRI
TSSIGDQQSALFGQLCLEKGQSKITYGTGCFILTNTGESIVKSTHGLLTTIAYSFKDKIH
YALEGSVMIAGAAVQWLRDNLKIVYSALETEWYAGQVNDDRRVYVVPSFTGLGSPYWDSY
SRGAIFGLDRGTKREHIVRATLEAIAYQANDVVSAMGKDMNDPVKLFKVDGGASNNKFMM
QFQSNISQSKVIKPVNIETTAMGAAFMAGLATGYWNSIDEIKQTYKVHFEITPEISTTEA
NKLIKGWDVAVKRTFNWTKDIE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatacatattaactttagatgaaggcacaaccagtgctagagcattaatagtt
aataaaaaaggtgagattattgctgttgagcaagccgaatttacacaacactttccaaaa
gaaggatgagttgagcatgatgcaattgaaatatgaaatactcaacgctcaacattagtt
caggtgcttaataaatcaaaaattagtcctgaacaaatcgattctattggcataactaat
caaagagagacagtagttatctgaaataaggaaactggattacctatttataatgctatt
gtttgacaagatcaaagaacagctgaatattgtcagtcgtttacaaaagagcaagttgaa
ttagtaaaagaaaagactggattaatcattaacccctatttttcagggacaaaagtaaaa
tgaatattagacaatgttcctaatgtaagagaattagcttcagaaggcaaattaatgttt
ggaactatcaatacatgactaatttataggcttactggtggaaaagtctttgcgacagat
cacactaatgcacaaagaacgcttttgtataacattcacactaacaattgagatgatgag
ttattaaaattattcgacattcctaaaagcatacttccggaaattaaatcatgcagcgag
gaatacggtctaactttcccacacttattttcaagagataatgaaagtcaaattagaatt
acttcttcaataggcgatcaacaaagtgcactatttggccagttatgcttagaaaaaggc
caatcaaaaattacatacggtacaggttgcttcattcttactaatacaggcgaatcaatt
gtaaaatctacacacgggttactaacaacaattgcttattcattcaaagacaaaatccac
tatgcactagaaggctctgtgatgatagcaggtgcagcggtgcaatgacttagagacaat
ttaaaaattgtttatagtgctttagaaactgaatgatatgcagggcaagttaatgatgat
agaagagtttatgtggtgccttcatttacaggtttaggttctccatactgagattcatat
tcacgtggtgcaatttttggccttgatagaggaactaaaagagaacatattgttagagca
acactagaagccattgcctaccaagctaatgatgttgttagcgctatgggcaaggatatg
aatgatcctgttaagttatttaaagttgacggtggtgcttcaaataataaatttatgatg
caatttcaatctaatatttcacaatcaaaagtaattaagccagtaaacattgaaactact
gctatgggggctgcttttatggctggtttagctactggttactgaaacagcattgatgaa
atcaaacaaacatacaaagtacattttgaaattactcctgaaatttctactactgaagct
aataaattaattaagggttgagatgttgctgtaaaaagaacatttaactgaactaaggat
atagaatag

DBGET integrated database retrieval system