KEGG   Mycoplasma agalactiae PG2: MAG_5120Help
Entry
MAG_5120          CDS       T00536                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAG_5120 (deoA)
Enzymes [BR:maa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MAG_5120 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599133..600428
Genome map
AA seq 431 aa AA seqDB search
MRIVDLIEKKRLGKSLSNEEIDFLLGSYVNGSTPDYQMAAFLMAVMFQGMESAELAYFTK
FMMHSGDVIDLSDIPGIKVDKHSTGGVGDKTTLAVAPICAALGAPVAKMSGRGLGHTGGT
IDKLESIPGFTVELTEAQFKKQVKKHKIAVIGQSSSLVPADKKIYALRDVTSCVQSIPLI
ASSIMSKKLATGSDAILLDVKCGNGAFMKTPELAKELSKTMISIGKELGVDVRAEITNMS
RPIGREIGNKNEVLEAIKTLQGNGPADFNELVYSSCATIMEQSKIAKSHEEGLKLVDEVI
KNGKALEKFYEFIALQGGDVEALKNPSFWSPKYSYDIYADKDGFLEIFDALAFGIVAMKL
GAGRATKEDKIDFEAGITLHKKTNETIKKGDKLFTLYSSKEINPELEKELSSAYKIGSEK
VKNKIIIDRLK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgttgatttaattgaaaaaaagagactaggcaagtctttaagtaatgaagaa
attgacttcttattaggctcatatgttaatggctcaactcctgattatcaaatggctgcc
tttttaatggcagttatgtttcaaggaatggaatcggctgagttagcctactttactaaa
tttatgatgcactctggcgatgttattgatctttctgatatcccaggaataaaagttgat
aaacactcaactggtggagttggcgataaaaccactctagcagttgctcctatttgcgca
gcattaggtgctccagttgccaaaatgtcaggtagaggacttggtcacactggtggaact
attgataaattagaatcaattccaggctttacagttgagcttactgaagcacaatttaaa
aagcaagtcaaaaaacacaaaattgctgtaataggacaaagcagttcgcttgtgcctgct
gataaaaaaatttatgcattaagagatgttacttcatgtgttcaatcaattccactcatt
gcttcaagcattatgtctaaaaaacttgcaactggaagcgatgcaattttgttagatgtt
aaatgtggcaatggtgcttttatgaaaacacctgaattagctaaagaactttctaaaaca
atgatctcaattggaaaagaactaggagttgatgttagggctgaaataactaatatgtca
agaccaattggtagagaaattggaaacaaaaacgaagttttagaagctattaaaactctt
caaggcaatgggccagctgattttaatgaattagtttactcatcatgtgcaacaattatg
gagcaatcaaaaattgctaagtcacatgaagaaggcttaaaacttgttgatgaagttatt
aaaaatggtaaggctttagaaaaattctatgaatttattgccttgcaaggtggtgatgtt
gaagcgcttaaaaacccttctttctgaagtccaaaatattcatatgatatttatgcagat
aaagacggcttcttagaaatttttgatgcactagcttttggaattgtagctatgaaacta
ggtgctggtagagctactaaagaagataaaattgattttgaagcaggcataacattacac
aaaaagaccaatgaaacaatcaaaaaaggcgataagctatttacactttactcatcaaaa
gagattaatcctgaattagaaaaagaactatcaagtgcatacaaaataggctcagaaaaa
gtaaaaaataaaatcattattgataggttaaaatag

DBGET integrated database retrieval system