KEGG   Mycoplasma agalactiae PG2: MAG_5140Help
Entry
MAG_5140          CDS       T00536                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
maa  Mycoplasma agalactiae PG2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:maa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAG_5140 (tpiA)
   01230 Biosynthesis of amino acids
    MAG_5140 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAG_5140 (tpiA)
   00051 Fructose and mannose metabolism
    MAG_5140 (tpiA)
   00562 Inositol phosphate metabolism
    MAG_5140 (tpiA)
Enzymes [BR:maa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAG_5140 (tpiA)
Exosome [BR:maa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAG_5140 (tpiA)
  Exosomal proteins of bladder cancer cells
   MAG_5140 (tpiA)
  Exosomal proteins of melanoma cells
   MAG_5140 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(601177..601953)
Genome map
AA seq 258 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANPQLIPYIDNNVFGVAPSQCNLTA
YFTNRVPELKLCSQNMSKNEEGAFTGEVSARMLQDINVSYALCGHSERRRYHTNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEAAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPEVPVLYGGSVNENNINDFTKLPNLNGFLVGSASLK
IDKFLKLISVNSDGIMPK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtaattggaaattgaaaaatgtataaaacatttactgaaacatta
aacttttttgatgaatttgcaatagaatacaaaaaatttagaaaagccaatccacaatta
attccttatattgataataatgtttttggtgtggctccttcacaatgtaatctaactgct
tattttacaaatagagttcctgaattaaaattatgcagccaaaatatgtcaaaaaatgaa
gaaggtgcttttactggtgaagttagcgccagaatgctacaagatatcaatgtttcatat
gctttatgcgggcactcagaaagaagaagatatcacacaaatcatgaaaatgatgaatcc
acgcacttaaaaattaagcaatcagttaagtatgacattactccaattatatgcattggc
gaatctaaggaagacagagatgctggtagaactgaagcagctattcataaacaattgcaa
attttgctagatgaagttaatattcataaagttattattgcctatgaaccagtttggtca
attggcactggcattactccaactcctgaagaagttgaaaacgtgagtgcattaattcat
aaattaactagccctgaagtacctgttttatatggcggaagtgttaatgaaaataatatt
aatgattttaccaaattgcctaatttaaatggctttttggttggttcagctagcttaaaa
attgacaaatttttaaagcttatttctgtcaattctgacggcataatgcctaaataa

DBGET integrated database retrieval system