KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0111cHelp
Entry
MAB_0111c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_7_1
Motif
Other DBs
NCBI-GeneID: 5962654
NCBI-ProteinID: YP_001700865
UniProt: A0A0S1SYC5
Position
complement(111415..112071)
Genome map
AA seq 218 aa AA seqDB search
MGFLTSRKSRSTKRAEARALKAKAKLEARLAARNDRRRMRVQARSESAARRDARKTELAT
LKAQRQIAQDQLRAVREGKLLSPTRIKRTLTVVRLLAPVLLPLLYKAAIAVRGVLDQRRA
DRLGIPLAELGQYSGFGAELSARIAGAEQSLQAVLDRAPKDAETKKFTATVRARLEELGT
AVGASEHMPPTRRRAAHAAIARELDGIDADLLARLGVR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcaccagccgcaagagccgctcgacgaaacgtgccgaggcgcgggcgctg
aaggcgaaagccaagctcgaagcccggttggcggcgcgcaatgaccggcgcaggatgcgc
gtacaagcgcggtcggagtccgctgcccggcgcgacgcgcgcaagacggagctggcgacg
ctgaaggcccagcggcaaatcgcccaggatcagctcagggcggtgcgggaaggcaagctg
ctctcgcccacccggatcaagcgcacgctcacggttgtgcggctgctagctcctgtgctg
ttgccgctgctgtacaaggcggccatcgcggtccgtggggtcttggaccagcgccgcgcc
gatcgactcggcataccgctggccgagctgggccagtactcgggattcggcgcagaactg
tcggcccgtatcgccggcgccgaacagtcgctacaggccgtgctggaccgtgcgcccaag
gatgccgagaccaagaagttcactgccaccgttcgtgcccggctcgaggaattgggtacc
gcggtgggggcatccgaacacatgccgccgacccggcggcgcgcggcacatgccgccatc
gcccgcgagctggacggcattgacgcggatctgctcgcacgactcggagtgaggtaa

DBGET integrated database retrieval system