KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0113Help
Entry
MAB_0113          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 Peptidase_U49 DUF4344 Peptidase_M48
Motif
Other DBs
NCBI-GeneID: 5962656
NCBI-ProteinID: YP_001700867
UniProt: A0A0U0X9D8
Position
113915..114406
Genome map
AA seq 163 aa AA seqDB search
MGAGRRVTDAVNAVLDLAPRKGEVTLTALVEAVGRDRDRSIEIISADLPPGVCGQWRQYE
NEDIFIIQRGLPTWDRTLAHELGHVVLRHEGISVVEMARDEAEFASDDLIAYMLSQRTGC
MGATGMEAEQEAEDFAALLLYRLGRLPSDRASIVQVRLGEAFG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaggccgtcgtgtgaccgatgccgtcaacgctgtgctcgaccttgctcctcgt
aagggcgaggtgacgctgaccgccctcgtcgaggccgtaggccgtgaccgcgaccggtcc
atcgagatcatctcggccgatctgccccccggggtgtgcggtcaatggcgccagtacgag
aacgaagacatcttcatcattcagcgcggcctacccacctgggatcgcacacttgcccac
gaactcggccacgtggtgctgcgccacgaaggtatctcggtagtcgaaatggcaagagat
gaagcggaattcgccagtgatgacctgatcgcctacatgctgtcgcagcgcaccggatgt
atgggggccaccggcatggaggctgaacaggaggccgaggacttcgcggcgctgttgttg
tatcggcttggccggctgccctccgaccgcgcgtccatcgttcaggtgaggctcggggag
gcctttgggtga

DBGET integrated database retrieval system