KEGG   Mycobacterium abscessus ATCC 19977: MAB_0116Help
Entry
MAB_0116          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962659
NCBI-ProteinID: YP_001700870
UniProt: A0A2C9Y9U1
Position
116943..117110
Genome map
AA seq 55 aa AA seqDB search
MGRWPQAAGRVLVDGGRTANSARIRRVRGEENDAGAGGVVLPPGTYRRTRELVMW
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggggcggtggccgcaggcagcggggcgggtactcgtcgacggcggccgcaccgcgaac
agtgctcggatacgtcgcgtgcgaggtgaggagaacgacgccggggccggtggcgtcgtg
ctgccgccaggaacctaccgacgtacccgggagctagtgatgtggtag

DBGET integrated database retrieval system