KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0119cHelp
Entry
MAB_0119c         CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962662
NCBI-ProteinID: YP_001700873
UniProt: A0A0U1AT55
Position
complement(118728..118883)
Genome map
AA seq 51 aa AA seqDB search
MTAQSAGHEPMSTSGWQLTPRCYNTSYRVAAFRALIIALILAAGLAFLILV
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacagtcggcaggacacgaacccatgtccacttccggctggcagttgactcct
cgctgctacaacacctcgtatcgtgtcgcggcctttcgcgccctgatcatcgccctcatc
ctcgcggccggtctcgcgtttctcatcctggtctaa

DBGET integrated database retrieval system