KEGG   Mycobacterium abscessus ATCC 19977: MAB_0134cHelp
Entry
MAB_0134c         CDS       T00657                                 

Definition
(RefSeq) Probable pyruvate dehydrogenase
  KO
K00156  
pyruvate dehydrogenase (quinone) [EC:1.2.5.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAB_0134c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.1  pyruvate dehydrogenase (quinone)
     MAB_0134c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(131476..133215)
Genome map
AA seq 579 aa AA seqDB search
MARTVSQLILDTVKAAGVQRIYGLPGDSLNGFTEALRRDGTLEWVHVRHEESAAFAAGAE
AALTGNLAVCAASCGPGNLHLINGLFDAHRSRVPVLAIASHIPSAEIGSGYFQETHPQNL
FAECSVYSELVSSVEQLPYVLDTAIRAALDQQGVAVLTIPGDILSAKVDLAPPSAPLVAG
AGIRLPGTSCLERAVRELNGSNAITILAGAGCEGAHAELLTAAHALQAPIVHTLRGKEFV
EYDNPFDVGMTGLLGFRSGYDALEDTEVLLMLGTDFPYRQFYPPKATVIQVDIRGEHIGR
RTRVDVALVGTVKDTLQQLNSMIQPHSDRRHLERARENYTRTRAQLDRLAVDDRNQTPVR
PELVARRIDELAADDAVFIADVGTPVIWAARYLSMNGRRRLLGSFNHGSMANAVPQAIGA
QASHRDRQIVTLSGDGGLTMMLGDLITLTQSQLPVKMVVFNNGALSFVELEMKAAGIVNY
GTALDNPVFADVAKALGIHGLRVERPDQLDGALSEAFDHPGPVLVEVLTARQELSIPPTI
TAAQVAGFSLWATRTLLSGRGDELIDLAKTNLGARLRRK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaccgtttcccagctcatcctcgacactgtgaaagccgctggtgtccaacgt
atttatggcctacctggagactcgctcaacggctttaccgaggcactgcggcgcgacgga
accctggagtgggtgcacgtgcggcacgaggaatctgccgcgttcgccgccggcgccgag
gccgcgctcacgggcaatcttgcggtctgtgcagcaagctgcggtcccgggaacctgcat
ctgatcaacggcctcttcgatgctcatcgcagccgggtgcccgtactcgcgatcgcatcg
catattcccagcgccgagataggcagcggctacttccaggagactcacccgcagaatctg
ttcgccgagtgcagcgtctacagcgagctggtgagcagtgtcgagcagctgccatatgtc
ctcgacaccgccatccgtgcggccctcgatcaacagggggtggcggtcttgacgatcccc
ggagacatcctgagcgccaaggtcgacctggcaccgccctctgctcccctcgtcgccggg
gccgggatcaggctgcccggtacgtcctgcttggaacgagccgtgcgggagctgaacggt
tcgaacgcgatcaccatcctggccggggcggggtgcgagggcgcccatgcggaactgctg
accgcggcccacgcgctccaggcacccatcgtgcacacgctgcgcggcaaggaattcgtc
gaatacgacaatcccttcgacgtcggtatgacgggcctgctcggcttccgctccggttac
gacgcactggaagacaccgaggtgctgctcatgctcggaacggacttcccgtaccggcag
ttctacccaccgaaggccaccgtcattcaggtcgacatccgcggtgagcacatcggccgg
cgcacccgagtagatgtcgcactcgtcggtacggtgaaagatactttacaacaacttaat
tcgatgattcagccgcattcggacaggagacacctggagcgcgccagagagaactacaca
cgcacacgagctcagctcgatcgcttggccgtggacgaccgcaaccagacgccggtgcgt
cccgagcttgtcgcccgccgaatcgacgagctggcggccgacgacgcggtcttcatcgcc
gatgtcggcacacccgtgatctgggcggcgcgatacctgtcgatgaacggccggcgccga
ttgctcggctcgttcaaccacggcagcatggcgaatgccgtaccccaagcgatcggcgca
caggcatcgcatcgcgatcgccagattgtcaccctctccggtgacggtggtctcaccatg
atgctcggcgacctcatcacgctgacccagtcccaactgccggtcaaaatggtcgtcttc
aacaacggtgcgctcagctttgtcgagctcgaaatgaaggccgccggtatcgtcaattac
ggtaccgccctggataatccggtgtttgcagatgtcgcaaaggctctcgggatccatggg
ctccgggtcgagcgccccgaccagctggacggcgccctttcggaagcctttgaccacccc
gggcccgtgctcgtggaggttctcaccgcgcgccaggagctgtcgattcccccgaccatc
accgccgcgcaagttgcgggattctcattgtgggccacccgaacgctgctgtccgggcgt
ggcgacgagctcatcgatttggccaagaccaatctcggagcacgcctgcgccgcaagtga

DBGET integrated database retrieval system