KEGG   Mycobacterium abscessus ATCC 19977: MAB_0146Help
Entry
MAB_0146          CDS       T00657                                 

Definition
(RefSeq) Putative magnesium transport MgtC family protein
  KO
K07507  
putative Mg2+ transporter-C (MgtC) family protein
Organism
mab  Mycobacterium abscessus ATCC 19977
Brite
Transporters [BR:mab02000]
 Other Transporters
  Others
   MAB_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
143651..144400
Genome map
AA seq 249 aa AA seqDB search
MALADSVAMFGGAGQGGRQLVGLLAAFVLSGIIGLEREIAGKSAGLRTQTIVGTSAALIL
LVSKYGFDDVLADGIVILDPSRVAAQIVSGIGFLGAGIIIMRRGAVHGLTTAAAIWESAA
VGMAAGAGLLLLAMVVTVLHFATVFGLAALGRLLTARLHGAVSLHVTYADGRGVLRQLLN
ACNAHRWSLLALSADPPAAPQTTDSISPGTAREVGVVMTLSGTRLDAATNVLAAVDGVHR
IDRLGDDIE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcggattctgtggcgatgttcggtggtgcgggccagggcggtcggcaactt
gtcgggctgctggccgcgttcgtgctatcggggattatcggcctggaacgcgagatcgcg
ggtaagagtgcgggattgcgcacacagacgattgtcgggacctccgcggcgctgatctta
ttggtgagcaaatacggttttgatgatgtgctggccgacggcatcgtgatccttgacccg
tcacgcgttgcggcgcagatcgtttcgggtatcggttttctgggcgccggaatcatcatc
atgcgccgcggggcggtgcacgggttgaccacggcggcggcgatatgggaatcggcggcg
gtgggcatggccgcgggcgccgggctactgctgctggcgatggtggtgactgtcctgcat
ttcgcaacggtattcggattggcggccttgggccgactgctcaccgcgaggctgcatggc
gctgtcagcctgcacgtcacctacgcggacggccggggtgtcctgaggcagctgctcaac
gcctgcaatgcacaccgctggtctttgttggcattgtccgccgacccaccggccgcgcct
cagaccaccgactcgatcagccctggcaccgcgcgtgaggtcggcgtggtgatgaccttg
tccggcacaagacttgatgccgcaacgaatgtgcttgcggcggtggacggtgtacatcgc
atcgaccggcttggcgacgatatcgagtag

DBGET integrated database retrieval system