KEGG   Mycobacterium abscessus ATCC 19977: MAB_0151cHelp
Entry
MAB_0151c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(147109..148782)
Genome map
AA seq 557 aa AA seqDB search
MSDEAEPTPKVERDDSTPDEPTNDELGTDASADSPVESPDSATPPAEAPGSASSAEGATE
SVDTEQAPATEILEYPDTDDSAVPVAEEPQQGAQESAKPQWWAGLKEGLKERSTHRALLL
VTFGGLFIAGVTQALPDGWTSADRLVNKIDSNPVPSTGAPGNSTFNSAKAGECLNWPAPA
STNDVNIVDCANDHRFEIAESIDLRTFPGTEYGPNSKPPTVGRIQEISQEQCQVAINRYL
GDRYDPNSRFTMGMLWPGEKGWTEAGERRVLCGLQLPGADNQQQLFRGKVAEQDQSKVWP
AGTCLGIDSTTNLPTELPVDCDKAHAMEITGTVSLAEQFPGSVPPEPDQDAFIKDNCTRL
TNDYMGNPDGFRATTLTLSYNTITLPSWTAGSRQVSCNIGSTLGNGAWSTLVNSAKSGQL
LINGQPPVPPPDIPADRLNMPPIPLSTTPAPTQQPTQTQQPTYTQQPTYTQQPTRTQQPT
QQTTQQPTRTSTAPTSSGAPSPPNQPGITIVTTLPPGAGPPPAPAGPPMDGPPMEGPPME
GPPPGQAPAGAPPPGPA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaagccgaacccacgccaaaggtcgagcgggacgactccaccccggatgag
cccaccaacgacgagctgggcaccgacgcatccgcagactcccccgtcgagtctccggac
tccgccacgccgcccgcagaggctccgggcagcgcgtcctccgcagagggcgccaccgaa
tccgtcgacaccgagcaggcgcctgcgacggaaatcctggaataccccgacaccgatgat
tccgccgtgcctgtggccgaggaaccgcagcaaggcgcccaggaatccgccaaacctcag
tggtgggcgggcctgaaggaagggctcaaagagcgttccacgcaccgcgcgctgctcctg
gtcacctttggtggcctcttcatcgcgggtgtcacccaagccctgccggacggctggacc
tcagccgaccgcctggtcaacaagatcgactccaacccggtacccagcacgggcgcaccg
ggtaacagcaccttcaactctgcgaaggcgggggaatgcctcaactggcccgcccccgcg
tccaccaacgacgtcaacatcgtcgactgcgccaacgaccaccgtttcgaaatcgccgag
tccatcgacctgcgtaccttcccgggtacggagtacgggcccaattccaagccccccacc
gtcggccgtatccaggagatcagccaggaacagtgccaggtggccatcaaccgttacctg
ggcgatcggtacgacccgaacagccgattcaccatgggcatgctgtggcccggtgagaag
gggtggaccgaggccggagaacgccgggtgctgtgtgggctgcaactacccggcgccgac
aatcagcaacagctgttccggggcaaggtcgccgagcaagatcagtccaaggtctggccc
gccggcacctgcttgggcatcgattcgaccaccaatctgcccaccgagctcccggtggat
tgcgacaaggctcatgccatggagatcaccggaacggtgagcctggcagagcagttccct
ggatcggttcctcccgagcccgatcaggacgcgttcatcaaggacaactgcacccggttg
accaatgactacatgggcaatcccgacggattccgcgcgaccacgctgacactgtcctac
aacacgatcaccttgccgagctggaccgcgggcagccgtcaggtcagctgcaacatcggc
tccacactgggtaacggcgcgtggtcaacgctggtcaatagcgccaagagtggccaactg
ctgatcaacggccagccgccggtgccaccgccggacatcccggccgatcggctgaacatg
ccgcccatcccgctgtcgaccacaccggcgcccacccagcagccgacccagactcagcaa
cccacctatacgcagcaacccacgtacacacagcagcccacgcgtacccagcaaccaacg
cagcagacgacccagcagccgacccggacgtccaccgcgccaacctcgtcgggcgcgccc
agtccccccaaccagccgggtatcaccatcgtgacgacgctgccgccgggggcgggcccg
cctccggctccggccggtccgcccatggacggtccgcccatggaaggccccccgatggag
gggccgccgcccggacaggcacccgcgggggcacctccgcccggaccggcctga

DBGET integrated database retrieval system