KEGG   Mycobacterium abscessus ATCC 19977: MAB_0153Help
Entry
MAB_0153          CDS       T00657                                 

Definition
(RefSeq) seryl-tRNA synthetase (SerS)
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab00970  Aminoacyl-tRNA biosynthesis
Module
mab_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MAB_0153
Enzymes [BR:mab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     MAB_0153
Amino acid related enzymes [BR:mab01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   MAB_0153
Transfer RNA biogenesis [BR:mab03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MAB_0153
 Prokaryotic Type
    MAB_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N Turandot YdfA_immunity
Motif
Other DBs
NCBI-GeneID: 5962696
NCBI-ProteinID: YP_001700907
UniProt: A0A0U0XN28
Position
149348..150604
Genome map
AA seq 418 aa AA seqDB search
MIDLKFLRENPDAVRASQRLRGEDPALVEVLLDADTARRAAISTADTLRAEQKAASKKVG
KATPEERPALLAAASELAAQVKSAEAEQVVTEAAFTEAHKAISNVVIDGVPAGGEQDFAL
RELVGEPHPIENPKDHVELGESLGLFDMERGAKVSGARFYFLTGYGALLQLGLLQLAVQT
AVANGFTLLIPPVLVKPEIMGGTGFLGAHADEVYHLEEDDLYLVGTSEVPIAGYHSGEIL
DLNNGPLRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVEAFVYCKPEDAEAEHEKILGW
ERQMLGHIEVPYRVIDVAAGDLGSSAARKFDCEAWVPTQRAYRELTSTSNCTTFQARRLA
VRYRDESGKPQIAATLNGTLATTRWLVAILENHQQPDGSVRVPTALVPFVGTEVLEPK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacctcaaattcctgcgcgaaaaccccgatgcggtgcgtgcctcacagcggctg
cggggcgaggatccggcactcgtcgaggtgctgcttgacgccgacacggcccggcgggcg
gccatatccacggccgatacgctgcgcgccgagcagaaggcggcaagcaagaaggtgggc
aaggcgacgcccgaggagcgcccggcactcttggcggccgcctcggaactcgccgcacag
gtcaagtcggctgaagccgagcaggtagtcaccgaggctgcgttcaccgaggcccataag
gcgatcagcaatgtggtgatcgacggagttcccgctggcggcgagcaggactttgcgctc
cgcgagttggtaggcgagccacacccgatcgaaaacccaaaggaccatgtggaattgggt
gagtcgctgggcctgttcgatatggaacgcggcgcaaaggtatccggtgcgcggttctac
ttcctcaccgggtacggcgcgctgctacagctgggcttgttgcagctggcggtgcagacc
gcggtggccaacggcttcaccctgctgatcccgccggtactggttaagccggaaatcatg
ggcggcacgggatttttgggtgcacacgccgatgaggtgtaccacctcgaggaggacgac
ctctatttggttggcacttcggaggtgcccatcgccgggtatcactccggcgaaatcctt
gatctgaataacgggccgctgcgctatgcggggtggtccagctgtttccggcgtgaggcc
ggcagttacggcaaggacacccggggcatcatccgggtacaccagttcgacaaggtcgag
gcctttgtctactgcaaacccgaagacgccgaggccgagcatgagaagatccttggctgg
gaacggcagatgctgggccacatcgaggtgccctaccgtgtgatcgatgtcgcggcaggc
gatttgggctcatccgcggcccgcaagttcgactgtgaggcgtgggttcctacgcagcgg
gcatatcgcgagctgacctccacctccaactgcacgacattccaggcacggcggttggcg
gtgcgttaccgggatgagagcggcaagccgcagatcgcggccactctcaacggcactctc
gccaccacccgatggctggtggcgatcctggagaaccaccagcagcccgatggcagcgtc
cgagtccccacggcgctggtgcccttcgtcggtaccgaagtgctggagcctaaatga

DBGET integrated database retrieval system