KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0158cHelp
Entry
MAB_0158c         CDS       T00657                                 

Definition
(RefSeq) ABC transporter, ATP-binding protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_21 AAA_15 SMC_N AAA_23 AAA_29 ABC_tran NACHT AAA_22 AAA_30 ABC_ATPase FtsK_SpoIIIE VirE AAA_16 AAA_27 RsgA_GTPase AAA_25 AAA_33 Dynamin_N RNA_helicase AAA_5 Polyketide_cyc2 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 5962701
NCBI-ProteinID: YP_001700912
UniProt: A0A2C9Y8L0
Position
complement(154064..154777)
Genome map
AA seq 237 aa AA seqDB search
MILREIAISREKQPDAWYFDIPAIARIAAEPLRLTTGVTVIVGENGSGKSTFLEALASAW
SWKLPAAVKHWGAQPSGEDTDLHWTFTLDAEHPRPSGGCFLRAEAMHQLFTTVDGRTPEQ
IFHGRLNERSHGESFLAFLAERDMERGLFILDEPEAALSFTSSLQLMAMLDGVVAAGSQV
IMATHSPVLAAFPGATVLEFDEDGVQQRDWDDLEMVGHWQRFLTDPRAYLRHLFAAE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgatccttcgtgagatcgcgatcagtcgtgaaaagcagccggatgcttggtatttcgac
attcctgcgatagcccgaatcgccgccgaacccctgcggctgaccaccggtgtcaccgtg
atcgtcggcgagaacggctccggcaagtcgactttcctcgaggcgctggcatccgcctgg
agctggaaactgccagccgccgtgaagcattggggggcacaacccagcggcgaggacacc
gacctgcactggacattcaccctcgacgcggaacatccacgccccagcggaggctgcttt
ctgcgtgccgaggccatgcatcaactgttcacaaccgtcgatgggcgcaccccggaacaa
atcttccacggcaggctcaacgagcgctcgcacggggaatcgtttctcgccttcctggcc
gagcgggacatggagcgggggctgttcatcctcgacgagcccgaggccgcgctgtccttc
acctcatcgctgcagttgatggccatgctcgacggtgtggtcgccgccggatcgcaggtc
atcatggccactcactcccccgtgctggccgccttccccggcgccaccgtcctggaattc
gacgaagacggtgtacagcaacgcgattgggatgacctggagatggtggggcactggcag
cgctttcttaccgacccgcgcgcctacctgcggcatctgttcgcagccgagtga

DBGET integrated database retrieval system