KEGG   Mycobacterium abscessus ATCC 19977: MAB_0161Help
Entry
MAB_0161          CDS       T00657                                 

Definition
(RefSeq) Probable transcriptional regulator, LysR family
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
156299..157189
Genome map
AA seq 296 aa AA seqDB search
MELSDITHFLAVAEAGGISHASKRLHTVQSNVSTHIKALEDELGVELFRRHARGMALTNA
GEAFLPYAERITALLREATQVVGDEAEPTGTLAIGSMETTAGLRLPGVLAAFAAACPRVD
FTLATGTTAELIDMVTDRRLDGAFVCGPIENDSLTTDLAFVEELVLLTAQRHTEISEVFG
APTRMLVFRNGCSYRARLQQIFTEQGVDPQVLEFGSLEGILGCVAADMGVSLLPAGVVSA
SQRATLLRMHPLPPMRARVETVFVRRADAALSPAMAQFLRELQRADTPVVLRSVAP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagtgacatcacgcatttcctcgcggtcgccgaggccggcggtatttcgcat
gcgtcgaagcgactgcacaccgtgcagtcgaacgtcagcacccacatcaaggcactggag
gacgagctcggagtggagctgtttcgtcggcatgcccggggcatggccctgaccaacgcg
ggtgaggcctttctgccgtatgcggagcgcatcacggcgttgctgagagaagccactcag
gtggtcggcgatgaggccgaacccaccgggacactggcgatcgggtccatggaaaccacc
gcgggactgcggctaccaggtgtcctggccgcatttgcggctgcgtgtccgcgggtggat
ttcaccctcgccacgggcaccactgccgagctgatcgacatggtgaccgatcgtcgactg
gatggtgcctttgtctgcgggcccatcgagaatgattcgttgacaacggatttagcattt
gtggaagagttggtcctgctgacggcccagcggcacacggagatcagcgaagtcttcggc
gcacccaccaggatgctcgtctttcgcaatggatgttcctatcgcgctcggctgcagcag
atcttcaccgagcagggcgttgatcctcaagtcctcgaattcggtagccttgaaggaata
ttgggttgcgttgcggcagatatgggtgtctccctgctgccggccggagtcgtcagcgcc
tcgcagcgtgcgacgctgctacgtatgcatccgttgcccccgatgcgggcccgcgtggaa
acggtgttcgtccgtcgcgccgatgcggctctttcaccggccatggcgcagttcctgcgt
gagctacagcgtgccgatacgccggtcgtgctgcgatcggtggcgccgtga

DBGET integrated database retrieval system