KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0166Help
Entry
MAB_0166          CDS       T00657                                 

Definition
(RefSeq) Putative acyltransferase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 5962709
NCBI-ProteinID: YP_001700920
UniProt: A0A0U0YMR3
Position
160194..160958
Genome map
AA seq 254 aa AA seqDB search
MEPVYRLLEITAHAAVFLTGTKVRYRGLGQVPSRGGAVIAINHTSYVDFLPAGLAMVRAG
RRMRFMLKAEMQEVPVMSFLIKHAKAIPVDRSAGHGAYEAAVDSLRSGEIVGVYPEATIS
RSFELKEFKTGAARMAHEAGVPIVPLIVWGAQRIWTKDHPKDLGRSRIPVNVAVGAALAA
SPDFERTTAELHDAMELLLVQAQQDYPSEPGAYWLPRRLGGTAPTVEEAAVLDSEELAER
ARRKARKKTDPGHA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggtttaccgactccttgaaatcacggcgcatgcggcggtcttcctcacgggg
accaaagtcagatatcgaggtttggggcaggttccgtcccggggtggcgcggtcatcgcg
atcaatcacaccagctatgtcgacttcctgcccgcggggctggcgatggttcgtgccgga
cggcggatgcggttcatgctcaaggcagagatgcaggaagtcccggtgatgagcttcctg
atcaaacatgccaaggcgattcccgtggatcgcagtgcgggccacggtgcctatgaggcg
gcggtggacagcctgcgcagcggagagattgtcggggtgtacccggaggcgaccatcagc
cgcagtttcgagctcaaggaattcaagaccggcgccgcgcggatggcccacgaagccggg
gtgcccatcgtgccgctcattgtctggggcgcgcagcgcatctggacgaaggatcatcca
aaggacttggggcgcagcagaattccagtgaatgtagcggtaggggccgcgttggcggcc
tcccctgatttcgagcgcaccaccgccgaattgcacgatgctatggagctgttgttggtc
caggcacagcaggactatcccagtgaaccaggtgcatactggttgcccaggcgtttgggc
ggcactgcccccacagtggaggaggcagccgtgctcgacagcgaggaactggccgaacgg
gcccgcaggaaggcccggaaaaagacggatccggggcacgcgtga

DBGET integrated database retrieval system