KEGG   Mycobacterium abscessus ATCC 19977: MAB_0166Help
Entry
MAB_0166          CDS       T00657                                 

Definition
(RefSeq) Putative acyltransferase
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
160194..160958
Genome map
AA seq 254 aa AA seqDB search
MEPVYRLLEITAHAAVFLTGTKVRYRGLGQVPSRGGAVIAINHTSYVDFLPAGLAMVRAG
RRMRFMLKAEMQEVPVMSFLIKHAKAIPVDRSAGHGAYEAAVDSLRSGEIVGVYPEATIS
RSFELKEFKTGAARMAHEAGVPIVPLIVWGAQRIWTKDHPKDLGRSRIPVNVAVGAALAA
SPDFERTTAELHDAMELLLVQAQQDYPSEPGAYWLPRRLGGTAPTVEEAAVLDSEELAER
ARRKARKKTDPGHA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggtttaccgactccttgaaatcacggcgcatgcggcggtcttcctcacgggg
accaaagtcagatatcgaggtttggggcaggttccgtcccggggtggcgcggtcatcgcg
atcaatcacaccagctatgtcgacttcctgcccgcggggctggcgatggttcgtgccgga
cggcggatgcggttcatgctcaaggcagagatgcaggaagtcccggtgatgagcttcctg
atcaaacatgccaaggcgattcccgtggatcgcagtgcgggccacggtgcctatgaggcg
gcggtggacagcctgcgcagcggagagattgtcggggtgtacccggaggcgaccatcagc
cgcagtttcgagctcaaggaattcaagaccggcgccgcgcggatggcccacgaagccggg
gtgcccatcgtgccgctcattgtctggggcgcgcagcgcatctggacgaaggatcatcca
aaggacttggggcgcagcagaattccagtgaatgtagcggtaggggccgcgttggcggcc
tcccctgatttcgagcgcaccaccgccgaattgcacgatgctatggagctgttgttggtc
caggcacagcaggactatcccagtgaaccaggtgcatactggttgcccaggcgtttgggc
ggcactgcccccacagtggaggaggcagccgtgctcgacagcgaggaactggccgaacgg
gcccgcaggaaggcccggaaaaagacggatccggggcacgcgtga

DBGET integrated database retrieval system