KEGG   Mycobacterium abscessus ATCC 19977: MAB_0167Help
Entry
MAB_0167          CDS       T00657                                 

Definition
(RefSeq) Putative hydrolase
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP HAD Hydrolase
Motif
Other DBs
NCBI-GeneID: 5962710
NCBI-ProteinID: YP_001700921
UniProt: A0A0U1BYE8
Position
160955..161773
Genome map
AA seq 272 aa AA seqDB search
MTHPALIASDVDGTLIDSAEILSARTRAVITAAVESGSAFVLATGRPPRWITPIVDALGF
APISVCANGSVLYDAENDRIISAATLSPSELAVLAEVAQAAIPGVGLAVERVGRSAHDAA
TPQFVSSPGYEHAWLNPDNTEVSLEDLLSFPAVKLLVRKAGARSSEMAEVLAPLVTEAGA
AITYSTDNGLIEVMPTGISKASGIAIVAKQAGVQPESIIAFGDMPNDVAMLRWAGHGVAM
GNAHPEARAAANEVTATNNDDGVAKVLERWWG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgacccatccagcccttatcgcgtccgatgtggacgggaccctgatcgattctgccgag
attttgtccgcacgcacgcgtgcggtcatcaccgccgcggtcgagtccggatcggccttc
gtcctggctaccggccgcccaccccgatggatcaccccgatcgtcgacgctctcggtttc
gcgccgatttctgtgtgtgccaacggttccgttctgtatgacgccgaaaacgaccggata
atctcggccgccacgctcagtccgtcggaactggcggtgctggccgaggtggcgcaggcg
gccatccccggggtgggcctggccgtggaacgggtggggcgcagtgcacacgatgccgcc
acgccgcagttcgtcagctcgccgggttatgagcatgcatggctgaaccccgataacacg
gaggtgtccctcgaggatttgctgagcttcccggcggtgaagttgttggtgcgcaaggct
ggagctcgtagctcggagatggccgaggtattggcgcccctggtgaccgaggcgggtgcg
gctatcacctattccaccgacaacgggctcatcgaggtaatgcccactggaatcagcaag
gccagcggaatcgcgatagtagcgaaacaggcaggggtgcagcccgaatcgatcattgcc
ttcggtgacatgcccaatgacgtcgccatgttgcgatgggcgggccacggagtggcgatg
ggtaacgcacacccggaggcgcgcgcggctgccaatgaggtgaccgccaccaataacgac
gatggcgtggccaaggttctcgaacgctggtggggctga

DBGET integrated database retrieval system