KEGG   Mycobacterium abscessus ATCC 19977: MAB_0169cHelp
Entry
MAB_0169c         CDS       T00657                                 

Definition
(RefSeq) Putative exported repetitive protein precursor
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(163739..164554)
Genome map
AA seq 271 aa AA seqDB search
MPNRRRRRLSTALSSVAALAVASPFAIALATNMTQAAAPAPSQQEFVQAAIVSDLPGEVM
GAVQQMTSQFGVQIPGLSGLNIPGLGGGGLGSLGGANPALTSPGGLTTPGGLTSPSSSLT
NPALTNPGLTSPSGSTTPSLTDPALTNPGLTNPAAPASTPGLTPAAGTGATGVNPALTDP
AAGLTSPGGEVPITPNPALGTGLTNPALADPSLAGLGTPTGLGGGSGLGGGSSLISDAMG
AVNQLGITQAVDLIKGAIPAAASAAAPPPAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaatcgtcgccgccgccggctttcgacagccttgagctcggtcgccgcgctggcc
gtcgcaagtccgtttgccattgccctcgcgaccaacatgacccaagcagccgcgcccgcg
ccttcccagcaggaattcgtgcaggccgcgatcgtgtcggacctgcccggagaggtcatg
ggcgcggtccagcagatgacttcacagttcggcgtccagatccccgggctctccggtctc
aacatccccggcttgggcggtggcggactcggcagcctgggcggcgccaaccctgccctc
acctctcctggtggcctcaccacgcccggcgggttgacttccccgtcatcgtcactgacg
aacccggcgctgaccaaccccggcctgaccagcccgagcggctccaccacaccgagtctt
accgacccggcgctcaccaaccccggtctgaccaacccggccgctcccgccagcaccccg
ggactgactcccgccgcgggcaccggtgcgacgggtgtgaacccggcgctgaccgatccg
gccgcggggctcacgtcccccggtggcgaggtccccatcacgccgaacccggcgctgggt
accggcctgaccaacccggccctggccgacccctcgctggcgggcctcggtacgcccacc
gggctcggcggtggcagcggattgggcggcggcagcagcctgatcagcgacgccatgggc
gcggtcaaccagctgggcatcacccaggcggttgatctgatcaagggcgccatcccggcg
gccgcctccgcggcggctccgcctccggccagctag

DBGET integrated database retrieval system