KEGG   Mycobacterium abscessus ATCC 19977: MAB_0172Help
Entry
MAB_0172          CDS       T00657                                 

Definition
(RefSeq) Probable phosphoesterase
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
168010..168573
Genome map
AA seq 187 aa AA seqDB search
MTGPLPGEVTAPQGETAVLVAVQSALGGRPGVLSTARGLSHFGEHSIGWVAAGLIGAAIN
RRDKPRRRSWLAAGAGAFGAHAASVIIKRLVRRRRPSHEAVRVNVSTPSRLSFPSSHATS
TAAAAVLFAPLTGLPLPALLIPPMALSRLVLGVHYPTDVAAGAALGALIGAAVRRADSRL
ALKEEQR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtccgctgccgggcgaggtcaccgcgcctcagggagaaaccgcggttctcgtc
gccgtgcagtcggccctcggcgggcgtcccggagtcctcagcaccgcgcgtggtctctcg
catttcggcgagcacagcatcggctgggtcgccgccgggctgatcggcgcggccatcaac
aggcgagacaagcctcgccggcgcagttggctggcggcgggtgcgggtgccttcggcgcg
catgccgcgtcggtcatcatcaagcggctggtgcgtcgccgccgtccgagccatgaggcg
gtgagggtgaacgtgagtaccccgagccggctcagtttcccctcgtcgcatgccacctcg
accgcggccgcggcggtgcttttcgcaccgctgaccgggttgccattacccgccctgctg
attccgccgatggcgttgtcgcggctggttctcggcgtgcactaccccacagatgtggcc
gcgggcgccgcgctcggtgcactgatcggcgcggccgttcgccgggcggactctcgtctg
gcgctcaaggaggaacagcgatga

DBGET integrated database retrieval system