KEGG   Mycobacterium abscessus ATCC 19977: MAB_0178Help
Entry
MAB_0178          CDS       T00657                                 

Definition
(RefSeq) Hypothetical cutinase precursor
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
175203..176213
Genome map
AA seq 336 aa AA seqDB search
MPKSSNSKRHRILGMAAALAVAVVVILVIAIVVVIVRRPADVTPGAQVPVTTTPPLTRPG
QKPRPAFQSADCPDVQALIIPGTWESSRTDDPLNPTEFPRSLLLNVSRPISEKFDKARLQ
TWTVPYTAQFHNPFANDNQMSYNDSRKEGTDRAVKQLSEMYDRCPLTSYVIIGFSQGAVI
AGDIANQIGNGEGPVDQDLVLGVTLIADGRRQDGVGQSPGPNPPGQGAEVTLGDLGVLDS
FGLKMTGPRPGGFGELNDRTNQICGTGDLICAAPPDAFNISNLGKTLDILSGGAGAPVHA
LYATPEFWQIDGNAATVWTTNWAEGLIENAPHPKHG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagagctcgaacagtaaacggcaccggattctcggtatggccgcggcgctggcc
gtcgccgtcgtcgtcattctggtgatcgcgatcgtcgtggtcatcgtccgcaggcccgca
gacgtcacgccgggtgcgcaggtgccggttaccacgacgccgccgttgacgcggccgggc
cagaagcccaggccggccttccagagcgcagactgccccgacgtgcaggcgctgatcatc
ccgggcacctgggagtcgtcccgcacggacgacccccttaatccgacagagtttccgcgc
tcattgctgctgaacgtgtcccggcccatcagcgagaagtttgacaaggcccggctgcag
acctggacggtgccctacaccgcccagttccataaccccttcgcgaacgacaaccagatg
tcatacaacgacagccgcaaggagggcaccgaccgggccgtcaagcagctctccgagatg
tatgaccggtgcccgctcaccagctacgtcatcatcggtttctcgcagggcgcggtgatc
gccggtgatatcgccaatcagataggtaacggtgaggggcccgtggaccaggatctggtg
ctgggcgtgacattgatcgccgatggccgtcgccaggatggcgtggggcagtcacccgga
ccgaacccgcccgggcagggcgcggaggtcactctcggggacctgggtgtgctggattcc
ttcgggctgaaaatgacgggcccgcgccccggcgggttcggcgagctcaacgaccgcacc
aaccagatctgtggcaccggcgacctgatctgtgcggcgcctccggacgcgttcaacatc
tccaacctgggtaagacgctggacattctctctggcggggcgggcgcacccgtgcacgcg
ctgtacgccacgccggagttctggcagattgacggcaacgccgcgacggtatggaccacc
aactgggccgaggggctcattgagaacgctccccacccgaagcacggatga

DBGET integrated database retrieval system