KEGG   Mycobacterium abscessus ATCC 19977: MAB_0188cHelp
Entry
MAB_0188c         CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962731
NCBI-ProteinID: YP_001700942
UniProt: A0A0U0XKW1
Position
complement(195237..195419)
Genome map
AA seq 60 aa AA seqDB search
MLRQIAWQFLVTASLASYLVTALPSHAKPKDDEPCPHHPVKVDPKCERSGAIREKSPHND
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgacaaatcgcctggcaattcctggtgactgcatccctggcgtcatatctggtg
acggcgttgcccagccacgccaagcccaaggacgacgagccctgtccgcaccacccggtc
aaggtcgatccgaaatgtgaacgctcgggagcgattcgcgagaagtcaccgcataacgac
tga

DBGET integrated database retrieval system