KEGG   Mycobacterium abscessus ATCC 19977: MAB_0197Help
Entry
MAB_0197          CDS       T00657                                 

Definition
(RefSeq) Putative alkylhydroperoxidase AhpD core
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
207716..208180
Genome map
AA seq 154 aa AA seqDB search
MTSTLNSPRIRMDKVSPEVYEAMMALSIASAKDVEPSLAELIKIRASQLNHCAFCLDMHT
HDARKQGETEQRIYLLNAWAEAGDIYTDREKAALALTEEATVLSAGEHVSDATYARAAAE
FTERELGQIIGMILTINAWNRIAVTTRNAPVRRG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcacactgaattcaccgcgcatccggatggacaaggtctcgcccgaggtttat
gaggccatgatggcgctgagtatcgcctcggccaaggatgtcgagcccagcctcgccgaa
ctcatcaagatccgtgcctctcagctcaatcactgcgccttctgtctcgatatgcatacc
cacgatgcccgcaagcaaggcgagaccgagcagcgcatctacctgctgaacgcctgggct
gaggcgggggatatttacaccgaccgggagaaggccgcgttggcgctcacggaggaagcg
accgtactttccgctggtgagcacgtgtccgatgccacctatgcccgggctgccgccgag
ttcaccgagcgtgagttggggcaaatcatcgggatgatcctgacgatcaacgcgtggaat
cgcatcgctgtcactacccgcaacgcacctgtgcgccgcggatag

DBGET integrated database retrieval system