KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0207cHelp
Entry
MAB_0207c         CDS       T00657                                 

Definition
(RefSeq) Probable quinone oxidoreductase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N adh_short
Motif
Other DBs
NCBI-GeneID: 5962750
NCBI-ProteinID: YP_001700961
UniProt: A0A2C9YA15
Position
complement(217436..218422)
Genome map
AA seq 328 aa AA seqDB search
MHAITVDNPGGPEALRWTEVPDPVPGPGEILIDVTAAAANRADLLQRRGLYSPPPGASSI
LGLECSGTVAALGADVAHWSVGQPVCALLSGGGYAEKVVAPATQLLPVPTNVQLDVAAAL
PEVACTVWSNMMMTTKMSAGQSILIHGGASGIGTHTIQVAKALGLRVAVTAGTPEKLDAC
RDLGADLAINYRDTDFVQAVHSFTDGSGVDRILDIMGAKYLSRNVDALGNDGHLVIIGMQ
GGVTAELNIAKLIAKRGSLTATTLRARPIAGPCGKAAIVESVAQNLWPLVEAGKVRPVVG
AEIPLSQAAEAHRLLENGAVVGKVLLTR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctatcaccgttgacaatccgggtgggccagaagcgctgcgctggacggaagtt
cccgatccagtcccgggtccgggcgagatcttgatcgacgtcaccgcagcggcagctaat
cgcgccgatctgctgcaacgtcggggcttgtacagcccgccgcccggagcaagctccatt
ctcgggctcgagtgttccggaaccgtcgcggcacttggcgccgacgttgcgcattggtct
gtgggacaacctgtttgcgcactgctttccggaggtggatacgccgaaaaagtggtggcg
cccgctacccagttgctgccggtaccgacgaatgtccagctcgacgtggccgccgcgctt
cccgaagtcgcgtgcacggtctggtccaacatgatgatgaccacgaaaatgtcagcgggg
caatccatcctgattcacggcggcgccagcggcattggcacccacaccatccaggtggcc
aaggccctcggcctgcgggtagcggtaacggccggcacacccgagaagctggacgcctgc
cgcgatcttggtgcagacctggccatcaactaccgcgacacagattttgtacaggctgtt
cacagttttaccgacggctccggcgtcgatcggattctcgacatcatgggagcgaagtat
ctgagccggaacgtcgacgccctcggcaacgacggtcacctcgtcatcatcggcatgcag
ggcggcgtgaccgccgaactgaacattgccaagctcatcgccaaacgtggctcgctcacc
gccaccaccctgcgcgcccgccccatcgcgggtccctgcggtaaggccgcgatcgtcgag
tcggtggcacagaacctctggccgctcgtcgaggcgggcaaggtccggcccgtggtcggt
gccgagatcccgctgagccaggccgccgaggcacatcgcctgctggagaacggcgcggtg
gtgggcaaggtgctgctgacccgctga

DBGET integrated database retrieval system