KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0226Help
Entry
MAB_0226          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962769
NCBI-ProteinID: YP_001700980
Position
236137..236853
Genome map
AA seq 238 aa AA seqDB search
MSVSTGYDERQALCCECGNLRSCRRPKNYREENFWLNRPVDRSWHRETGDLKCEHCARTT
RHALLYREGDGFKDHAERLERIALGGSDPLDAESSGVTEQIKKNYRIGRQTNPHLRHSWW
TGDADQARALGTSTVVTLCGDKYEIPDNPVAYDDDEDEIGPAQTRAAQYHRQIFSDDSPP
EGWDYQDCPDCTRVVNEWVIERNRNYLMAKLTKLMRTAFDLNAPALERLIAVVEQAEL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaagcaccgggtacgacgagcggcaagcgctctgctgcgagtgcgggaacctg
cgcagctgccgtcgacccaaaaactatcgtgaagagaacttctggctgaaccgaccagtg
gaccgaagctggcaccgggaaaccggtgacctcaaatgcgagcactgcgcgcggactact
cggcacgccctcctctaccgggaaggtgacggcttcaaggatcacgccgagcggctggag
cggatcgcgctcggaggcagtgacccgctcgatgcggaatcgtcgggcgtcaccgagcag
atcaagaagaactaccggatcgggcgccagaccaacccccacctacgtcactcgtggtgg
accggtgacgccgatcaggcgcgggcgctgggtacgtccacggtcgtcactctttgcggc
gacaagtatgaaatacccgacaacccagtggcatacgacgacgatgaagacgagatcggc
cccgcccagactcgcgccgcccagtaccaccggcagatcttttccgatgattccccaccc
gagggatgggactatcaggactgcccagactgcacgcgcgtagtcaatgaatgggtcata
gaacgcaatcgcaactacttgatggccaagctcaccaagttgatgcgcaccgcctttgat
ctgaatgcacctgcgctggagcgccttatcgcagtcgttgagcaggcggagctatga

DBGET integrated database retrieval system