KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0228Help
Entry
MAB_0228          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962771
NCBI-ProteinID: YP_001700982
Position
237158..237334
Genome map
AA seq 58 aa AA seqDB search
MTDHEEETGRHDRPTLYDILGADGECTECGAGVGEVCRFTNGVKKKVPHGSRWRRRAG
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacgaagaagaaaccgggcgacacgaccggcccaccctctacgacattctc
ggcgctgatggtgagtgcacggaatgcggtgcaggcgtgggcgaggtgtgccggttcacc
aatggcgtgaagaagaaggtgccgcacggatcacggtggaggaggcgggccggatga

DBGET integrated database retrieval system