KEGG   Mycobacterium abscessus ATCC 19977: MAB_0233Help
Entry
MAB_0233          CDS       T00657                                 

Definition
(RefSeq) Putative phage tail tape measure protein TMP
Organism
mab  Mycobacterium abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
239529..243512
Genome map
AA seq 1327 aa AA seqDB search
MAVELASGYVSLSVRVGATSGLGKLFDNAQKQATSAGKKTGEAFAKALASEAKAAEEQVK
KLTDTVTKSRDKEADQAGKLKVALEKLNEARQGGVSGSKLTALEESHAAALRKQQAAAQD
LAKDLDAVTRAQRRATDAQAAVGRAPKNVQNRVSQLLSGSADAAGHAGGLAGRRFGDSFS
GALRSTGIVAAGTAVGNLAANAMTKAASFATSGVSAVVTKGLDFEKTMNTLSGVTGASAD
VMQRFRDTAKALGNDMTLSNTSAADAAQAMTELAKAGFSVDESIAGAKGTLQLAAAAQVD
AGKAAEIQANALLAFGLKADYASKAADVLSNAANASSAEITDVAQALQSGGAVANQFGLK
LEDTAAAIGLLANNGIKGSDAGTLLKSALLALTDTSNPAQGAIEELGLTVYDAQGRFVGL
EKLFGDLQAASQRMTPEMYQAATTTLFGSDAARLAGIAAKDGAAGYDQMRDAMEKQGSAA
KLAAAQNQGLPGVIERLKNAAETLAITLFEKVQGPLSSIGDGLTGFTNKMQDAFENPAVS
QAAGAIGAALSGIGAAFGRILSAVGPALVGGLSNAVNLIVRFKDFLIPLVAGLVAYKTVM
LAITVATKAWAAVQALLNIALTANPIGLIIAAIAGLVAGIVVLYNRNETFRKIVQTTWAA
IKTAISAVWNWLSTTVFPGLKLAFTAIGTAATWLWNNAITPAWNGIKAVIGVAWEVVSDI
FNNWVRVGQLVGQGAMWLWNNAIQPAWDGIKNAISAAWDFVSPILDKFSAGWDALKSGIS
SASSAIKDAVTSAFSGLAAVIKAPLKLLGTFLASIPSEVFGFQIPGADKLNSWGKSLQGF
AAGGLVRGPGSGTSDSILAWLSNGEGVVTAKGMKHGAGIVAALNSGWVPSPAYLADMMRA
PGYAEGLNPGADYLRSLVMRMWPQIKSIGGRRSEDGFGEHSTGNAIDIMIPNYQTPQGMA
LGNAIAAFLANNASALDLNGFIWRRQSYGYGGSFTSGTPMDDRGDDNKNHMNHVHVILGS
GRGSGAAAVGLPTSNISLPSGGSVAARAMGNTGSSGGSSKQAREADDRITDLSNRLDVTE
QELADLESNPKAKETTKQRKRDMVDKLKRDLQQAKDDRASLDLGGSSGGFGGGNNPYAKI
MEGISEILPDFGGLADIGIGGLKESLLPPGFSDPMQWGFMQAGSTLLKFFGGLRNVSDGK
PLLGEGGALMANITGAAMSGSGSGIVDAIKTIIPAPFGSMDAAQLQGAPGDINPVIAGAQ
IPGTGFGDMGSAFSQGSAAPNGNGSPVDQSINFNAPVGTGVDQAMQKAQSAQNQQYRRNN
GTRTMPS
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgaactcgcatcagggtatgtgtccctgtcggttagggtcggggccacctcg
ggtttgggcaagctctttgataacgcgcagaagcaagccacgagcgcaggtaagaagacc
ggcgaagccttcgccaaagctcttgcttccgaagcgaaagccgccgaggagcaggtaaag
aagctcaccgacaccgtaaccaagtctcgggacaaagaagctgaccaggcaggcaagctc
aaggtagcgctggaaaagctcaacgaggcccgccagggcggtgtctcagggtcgaaactc
accgccctggaggaatcccacgccgccgcgctacgcaagcaacaggccgccgcacaggat
ctagccaaggatctagatgctgtcacccgcgcacagaggcgggccaccgatgctcaagcc
gccgtggggcgcgcgccgaagaatgttcagaaccgtgtctcgcagctgctctccggctct
gctgatgcagcggggcacgccgggggtttagccggtcgcaggttcggtgattcattctct
ggcgctttgcgttccacaggcattgtggcagccggtacagcagtgggaaacctggccgcc
aatgcgatgaccaaggctgccagtttcgccaccagcggagtttccgcggtggtgactaag
ggtctggacttcgagaagaccatgaacaccctctcgggtgtcacaggtgcttcggcagac
gtgatgcagcggttccgcgacaccgccaaggccctcggcaacgacatgacgttgtcgaac
acctcggctgctgatgctgcacaggccatgaccgaactcgccaaggccggtttctcagtg
gatgagtcgattgccggcgccaagggcaccctgcagctggccgctgctgcgcaagtcgat
gcgggcaaggctgccgagattcaagccaacgccctgttggccttcggtctcaaagccgac
tacgcctctaaggccgcagatgtgttgtcgaatgcggccaacgcatcctcggcggaaatc
accgacgtggcacaggcattgcagtccggtggcgcggtcgccaaccagttcggcctcaag
ctcgaagacaccgccgccgcgatcggcctgctggccaacaacggcatcaaaggctccgat
gccggaaccctgctcaagtccgcgctgctggcactgacggacaccagcaacccggcacaa
ggcgctattgaagagctcggtctgaccgtctatgacgcccaaggccgattcgtggggctg
gagaagctattcggggacttgcaggccgcctcccagcggatgacaccagagatgtaccag
gcggccaccacaaccctgttcggctccgatgcggcccgcctggccggcatcgccgccaag
gacggtgccgctggatatgaccagatgcgcgacgccatggaaaagcaaggctcggctgcc
aagctcgccgcagcgcagaaccaaggactaccgggggtcattgaacggctaaagaacgcc
gccgaaaccctggccatcaccctgtttgagaaggtccaaggcccgttgtcgagcatcggg
gacggactgaccgggtttaccaacaagatgcaggacgctttcgagaaccctgccgtaagc
caggcagccggggctatcggtgccgccctgtccggtatcggggccgcgttcggacggatc
ctgtcagccgtgggtccggcgttggtgggcgggttgtcgaacgctgtcaacctgatcgtc
cgcttcaaagacttcctaatccctctcgtcgccggtctagttgcttacaagacggtgatg
ctcgctatcaccgtggccacgaaagcgtgggccgcagtccaagccctgctgaatatcgct
ttgaccgccaacccaattggtttgatcatcgccgccatcgcaggtttggtcgccggaatc
gtagtgctatacaaccgcaacgagacattccgaaagattgtccaaaccacttgggcggca
ataaagacagcgatatcggcagtgtggaattggctatcgaccaccgtattccccggcctg
aaactggcattcaccgctatcgggaccgccgccacctggttgtggaataacgcgataacc
ccggcctggaatggcatcaaagccgtcatcggtgtcgcgtgggaggttgtctccgacatc
ttcaacaactgggtgcgggtcggccagctcgtcggacaaggtgcaatgtggttgtggaac
aacgcaatccaaccggcatgggacggaatcaagaacgcgatcagcgccgcgtgggacttt
gtatcgcccattctcgataagttctccgccggatgggatgcactcaagtccggcatttcc
agcgcctccagcgcgatcaaagatgctgtcacatccgcattctcgggactagccgcagtc
atcaaagcgcccctgaaattgctgggcacattccttgcctctatcccgtctgaggtattc
gggttccagatccccggcgcagacaaactcaactcgtggggtaaatccctacagggcttc
gccgcaggcggattggtgcgcggacccggctcgggtacttctgattccatcctggcgtgg
ctatccaacggcgaaggagtggtcaccgccaagggaatgaagcacggcgcgggaatcgtc
gcggccctgaactcaggctgggtgccatcgcccgcatacctggccgacatgatgcgcgcc
cccggatatgccgagggcctgaatcccggcgcggactatctgcggtccctggtgatgcgg
atgtggccgcagatcaaatccatcggcggcaggcgctccgaggacggctttggcgagcac
tccacggggaacgcgattgacatcatgattccgaactaccaaaccccgcaaggtatggcg
ctcggaaacgcaatcgcagctttcctggccaacaacgccagcgccctagacctcaacgga
ttcatctggcgtcggcaaagttacggctacggcggttcgttcactagcggcaccccaatg
gatgatcgcggcgacgacaacaagaaccacatgaaccacgtgcacgtgattctgggctct
ggcagaggatctggcgccgcagcggtaggactaccgacaagcaacatctctctgccgtcc
ggtgggtccgtggccgcacgagcgatgggcaacaccggatcttccggcggctcatcgaaa
caggcccgcgaggccgatgaccggatcacggacctgtcgaaccggctcgatgtcaccgag
caggaattggccgacctggagtccaacccgaaggctaaagagaccaccaagcagcgcaag
cgtgacatggtcgacaagctcaagcgcgacctgcagcaggccaaggatgatcgggcatcg
ctagacctgggtggttccagtggtggattcggtggcggcaacaacccgtacgccaagatc
atggagggaatctccgagatcttgccggacttcggcggcctggccgacattggtatcggt
gggctcaaggaatcgcttctgcctccagggttctcggacccgatgcagtggggctttatg
caagccggttcgaccctgctgaagttcttcgggggcctgcgcaacgtctccgatgggaaa
cccctacttggtgagggcggggcgctcatggccaacatcaccggcgctgcgatgtccggg
tctggcagcggaatcgtcgacgcgatcaagacaatcattccggctccgttcggcagcatg
gacgccgctcaactccaaggggcaccaggcgatatcaatcccgttatcgcgggtgctcaa
atccccggcaccggattcggcgacatgggttcggccttctcgcaaggcagtgcggcaccc
aacggcaacgggtctccggtcgaccagtccatcaacttcaacgccccagtaggtacggga
gtggatcaggcgatgcagaaagcccagtccgcgcagaaccagcagtaccgccgcaacaac
ggcacacggacgatgccgagctga

DBGET integrated database retrieval system