KEGG   Mycobacterium abscessus ATCC 19977: MAB_0320Help
Entry
MAB_0320          CDS       T00657                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mab03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321765..322373
Genome map
AA seq 202 aa AA seqDB search
MFEGPVQDLIDELGKLPGVGPKSAQRIAFHLLGVEAPDIDRLTAALTRVRDGVQFCEVCG
NVSDKERCRICADPRRDIALVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLTRIGTEEDGVSISEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRPL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagggcccggtccaggacctcattgacgagctgggcaagctgcccggggtaggg
cccaagagcgcgcagcgcatcgcattccatttgttgggtgtcgaggcgcccgatatcgat
cgactgaccgctgcactgacgagggtgcgcgacggcgttcagttctgcgaggtgtgcggg
aacgtctccgataaggagcgttgccgcatttgcgctgatccgcgccgtgacatcgcgctg
gtctgcgttgtcgaggaacccaaggatgtgcaggcggtcgaacgcacccgtgaattccgg
ggccgctaccacgtgctcggcggcgcgctggatccgctctcgggagtcgggcccgatcag
cttcggattcgggaactgttgacccgcataggaaccgaggaggatggggtgtccatctcc
gaggtcatcatcgctaccgacccgaataccgagggcgaggccaccgcgacctacttggtg
cggatgctgcgcgacttccccgggctcaccgtcacccgattggcctccggcctaccgatg
ggcggagacctggaattcgccgatgagctgacgctcggacgtgccctctcgggtcgccgc
cccctctga

DBGET integrated database retrieval system