KEGG   Mycobacterium abscessus ATCC 19977: MAB_0320Help
Entry
MAB_0320          CDS       T00657                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAB_0320
DNA repair and recombination proteins [BR:mab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MAB_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321765..322373
Genome map
AA seq 202 aa AA seqDB search
MFEGPVQDLIDELGKLPGVGPKSAQRIAFHLLGVEAPDIDRLTAALTRVRDGVQFCEVCG
NVSDKERCRICADPRRDIALVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLTRIGTEEDGVSISEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRPL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagggcccggtccaggacctcattgacgagctgggcaagctgcccggggtaggg
cccaagagcgcgcagcgcatcgcattccatttgttgggtgtcgaggcgcccgatatcgat
cgactgaccgctgcactgacgagggtgcgcgacggcgttcagttctgcgaggtgtgcggg
aacgtctccgataaggagcgttgccgcatttgcgctgatccgcgccgtgacatcgcgctg
gtctgcgttgtcgaggaacccaaggatgtgcaggcggtcgaacgcacccgtgaattccgg
ggccgctaccacgtgctcggcggcgcgctggatccgctctcgggagtcgggcccgatcag
cttcggattcgggaactgttgacccgcataggaaccgaggaggatggggtgtccatctcc
gaggtcatcatcgctaccgacccgaataccgagggcgaggccaccgcgacctacttggtg
cggatgctgcgcgacttccccgggctcaccgtcacccgattggcctccggcctaccgatg
ggcggagacctggaattcgccgatgagctgacgctcggacgtgccctctcgggtcgccgc
cccctctga

DBGET integrated database retrieval system