KEGG   Mycobacterium abscessus ATCC 19977: MAB_0382Help
Entry
MAB_0382          CDS       T00657                                 

Definition
Glycerol kinase (GlpK)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MAB_0382
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MAB_0382
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAB_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377959..379473
Genome map
AA seq 504 aa AA seqDB search
MADFVASIDQGTTSTRAMIFNHRGEEVGRHQLEHQQLLPRAGWVEHNPVEIWERTWSVLA
TSLNVTGLSAGDLAAVGVTNQRETTLVWNRHTGRPYCNAIVWQDTRTDKIAAALDRDGRG
DIIRRKAGLPPATYFSGGKLQWILENVEGVRRDAENGDALFGTPDSWVIWNLTGGVRSGV
HVTDVTNASRTMLMNLETLDWDDELLSFFSIPRQMLPPIKASSPVEPFGFTTQLGPLGGE
VPIAGDLGDQQAAMVGQVCLNPGEAKNTYGTGNFLLLNTGEELVHSSNGLLTTVCYQFGD
NKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSEDLARQVEDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLEAICYQSREVVEAMEADSGVRMEVLKVDGGITAN
KLCMQIQADTLGVDVVKPVVAETTALGAAYAAGLAVGFWKDADDLRRNWQEDERWSSSIT
DEKRAEGFAGWKKAVQRTLDGVDV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttcgtggcatcgatcgaccaaggcactaccagcacacgcgccatgatcttc
aaccacaggggcgaggaagtgggccgccatcagctggagcatcagcaactgctgccacgg
gcgggctgggtggaacacaacccggtggagatctgggagcgcacctggtcggtgttggcc
acgtctctcaatgtgaccgggctatcggccggtgatctcgctgccgtcggggtgaccaat
cagcgtgagaccaccttggtgtggaaccgccacactggtaggccgtactgcaatgccatc
gtgtggcaggacacccgcaccgacaagatcgccgcggcactggaccgcgacgggcgtggt
gacatcattcggcggaaggccggactacctcccgccacttacttttcgggcgggaagctg
caatggattctggagaacgtcgagggggtgcggcgggatgcggagaatggtgacgcgctc
ttcgggacgcccgacagctgggtgatctggaatctcaccggcggtgtccgcagcggggta
catgtcaccgatgtgacaaatgccagtcgcaccatgttgatgaacctggagaccctggac
tgggatgacgagctgttgtcgttcttttccattccgcgccagatgcttccgccgatcaag
gcgtcgtcgccggtggagccgttcggcttcacgacgcagctgggtccgctgggcggagag
gttcccatcgccggcgatctgggtgatcagcaggccgcgatggtggggcaggtgtgcctg
aaccccggcgaggccaagaacacctacggcaccggaaacttcttgctactcaacaccggt
gaggaactggtccattcgagcaatgggctgttgaccaccgtctgttatcaattcggcgac
aacaagccggtgtatgcgctggagggatcgatcgcggtgacgggctccgcggtgcagtgg
ctgcgcgaccagctgggcatcatcagcggtgcctcgcaaagcgaggacctggcgcgccag
gtcgaggacaacggcggcgtctatttcgtgccggccttttccgggctgttcgcgccgtac
tggcgatcggatgcacgcggcgccatcgtgggtctgtcccggttcaacaccaacgcgcac
ctggcgcgcgcgacactcgaagccatctgttaccagagccgggaagtggtcgaggccatg
gaggcggactcgggtgtgcggatggaggtgctcaaggtcgatggcggtatcaccgccaac
aagctctgcatgcagatccaagccgacaccctgggtgtggacgtcgtcaaacccgttgtc
gccgagactactgcgctgggcgcggcgtacgcggcgggcttggccgtgggtttctggaag
gacgccgacgacctgcggcgcaactggcaggaagacgaacgctggagctcgtcgatcacg
gacgagaagcgcgccgagggtttcgcgggctggaagaaagccgtgcagcgcacgctggac
ggggtggacgtctaa

DBGET integrated database retrieval system