KEGG   Mycobacterium abscessus ATCC 19977: MAB_0398cHelp
Entry
MAB_0398c         CDS       T00657                                 

Definition
(RefSeq) Exodeoxyribonuclease V, alpha subunit (RecD)
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAB_0398c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MAB_0398c
DNA repair and recombination proteins [BR:mab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MAB_0398c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD-helicase PhoH AAA_28 AAA_29 Mg_chelatase DUF3322 AAA_16 Herpes_Helicase UvrD_C T2SSE NTPase_1 AAA_23 AAA_5 SRP54 NACHT DUF2075 AAA CbiA cobW
Motif
Other DBs
NCBI-GeneID: 5962935
NCBI-ProteinID: YP_001701151
UniProt: A0A2C9Y949
Position
complement(393871..395529)
Genome map
AA seq 552 aa AA seqDB search
MSLVEAFGEILEPADVHVAQRLTALASETDESVELAIALAVRALRGGSVCVDLRAVAAQV
DMPSLPWPAADDWLAAVRASPLAGEPPVLRLFGDLLYLDRYWREEQQVCTDVQALMAAAQ
PRTEVPTYERLFPQGFEEQRAAADIALSQGLTVLTGGPGTGKTTTVARLLALLADQASSA
SAAPLRIALAAPTGKAAARLQEAVQLEVNQLDAVDRSRLAGLQATTLHRLLGSRPDTSSR
FKHDRGNRLPHDVIVVDETSMVSLTMMARLLEAVRPQARLLLVGDPDQLASVEAGAVLAD
LVEGLESERVAALRTSHRFGAAIGALAAAVRDGDADRALEVLASGDPHVEWSTDSEGLRD
VLVPQALALRAASLSGDATAALAVLDEHRMLCAHRHGPFGVTHWNRQVERWITEETGEPH
WAPWYAGRPILVTANDYGLRLYNGDTGVTVAGPDGLRAVIGAASFATSRLVEVETMHAMT
IHKSQGSQANEVTVLLPSEDSRLLTRELFYTAVTRAKQRVRVVGSEAEVRAAIQRQAVRA
SGLGRRLRHSPN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggtggaggcgttcggcgagatcctcgaacccgcggatgtgcatgtggcgcag
cggctgacggcgttggcatccgagaccgatgagtcggtggagctggcaatcgcgctggcg
gtgcgggcactgcgcggcgggtcggtgtgtgtggatttgcgcgcggtggcggcgcaggtg
gatatgccctcgctgccgtggcccgctgccgatgactggctggcggcggtgcgggccagc
cccttggcgggtgagccgcccgtgctgcggcttttcggcgacctgctgtacctcgatcgg
tactggcgcgaggaacaacaggtgtgcacagatgtgcaagcgttgatggccgccgcccaa
ccacgcaccgaagtgcccacctatgagcgacttttcccgcagggattcgaagagcagcgc
gccgctgccgatattgcgctgtcacagggcctgaccgtgctgacgggcgggccgggcacg
ggcaagaccaccacggtggcacggctgttggcgctgctggccgaccaggcatcatcggcg
agcgccgcgccgttgcgtatcgcgctggcagcaccgacaggcaaggccgcggcccggctg
caggaagcggtgcagctggaggtcaaccagctggatgccgtcgaccggtcgcggttggcc
gggttgcaggcgaccacgctgcatcgtctgttgggatcgcgccccgacacgtcgtcccgg
ttcaaacatgatcgcggaaaccggttgccgcacgatgtgattgtggtggacgagacgtcg
atggtgtcgctgaccatgatggcgcgactgttggaggcggtgcgcccgcaggcccgactg
ctgctggtgggtgatcctgatcagctggcctcggtggaggcgggcgcggtgctggccgat
ctggtcgagggcctggagtccgaacgggtggcggcactgcgcacgtcgcaccgtttcggt
gcggcgattggcgcgttggcggcggcggtgcgtgacggagacgcggatcgcgcgctagag
gtgctggcatctggcgatccgcatgtggagtggtcgacggattcagaggggttacgcgat
gtgcttgtcccccaggcacttgcattgcgtgcggcaagcctgtccggtgatgccacagcg
gcgctggccgtgctcgacgagcaccggatgctatgcgcgcatcgccacgggccgttcggg
gtgacgcactggaaccgccaggtggagcggtggatcaccgaggagacgggcgagccgcac
tgggcaccctggtatgcgggaagaccgatcctggtcaccgccaatgactatggcttgcgt
ctgtacaacggtgacaccggcgtgacggtggccggacctgacgggctgcgcgcggtgatc
ggcgcagcatcgtttgcgaccagccgtctggttgaggtggagaccatgcacgccatgacc
attcacaagtcccagggcagccaggcgaatgaagtgacggtgctgctgccgtctgaagat
tcccggctgctgacacgcgagctgttctacacggcggtcacgcgcgccaagcagcgcgtg
cgggtggtgggctcggaggccgaggtgcgggccgcgatccagcggcaggcggtgcgggcg
tcggggttggggcggcgactgcgccacagcccgaactga

DBGET integrated database retrieval system