KEGG   Mycobacterium abscessus ATCC 19977: MAB_0398cHelp
Entry
MAB_0398c         CDS       T00657                                 

Definition
Exodeoxyribonuclease V, alpha subunit (RecD)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAB_0398c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MAB_0398c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(393871..395529)
Genome map
AA seq 552 aa AA seqDB search
MSLVEAFGEILEPADVHVAQRLTALASETDESVELAIALAVRALRGGSVCVDLRAVAAQV
DMPSLPWPAADDWLAAVRASPLAGEPPVLRLFGDLLYLDRYWREEQQVCTDVQALMAAAQ
PRTEVPTYERLFPQGFEEQRAAADIALSQGLTVLTGGPGTGKTTTVARLLALLADQASSA
SAAPLRIALAAPTGKAAARLQEAVQLEVNQLDAVDRSRLAGLQATTLHRLLGSRPDTSSR
FKHDRGNRLPHDVIVVDETSMVSLTMMARLLEAVRPQARLLLVGDPDQLASVEAGAVLAD
LVEGLESERVAALRTSHRFGAAIGALAAAVRDGDADRALEVLASGDPHVEWSTDSEGLRD
VLVPQALALRAASLSGDATAALAVLDEHRMLCAHRHGPFGVTHWNRQVERWITEETGEPH
WAPWYAGRPILVTANDYGLRLYNGDTGVTVAGPDGLRAVIGAASFATSRLVEVETMHAMT
IHKSQGSQANEVTVLLPSEDSRLLTRELFYTAVTRAKQRVRVVGSEAEVRAAIQRQAVRA
SGLGRRLRHSPN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggtggaggcgttcggcgagatcctcgaacccgcggatgtgcatgtggcgcag
cggctgacggcgttggcatccgagaccgatgagtcggtggagctggcaatcgcgctggcg
gtgcgggcactgcgcggcgggtcggtgtgtgtggatttgcgcgcggtggcggcgcaggtg
gatatgccctcgctgccgtggcccgctgccgatgactggctggcggcggtgcgggccagc
cccttggcgggtgagccgcccgtgctgcggcttttcggcgacctgctgtacctcgatcgg
tactggcgcgaggaacaacaggtgtgcacagatgtgcaagcgttgatggccgccgcccaa
ccacgcaccgaagtgcccacctatgagcgacttttcccgcagggattcgaagagcagcgc
gccgctgccgatattgcgctgtcacagggcctgaccgtgctgacgggcgggccgggcacg
ggcaagaccaccacggtggcacggctgttggcgctgctggccgaccaggcatcatcggcg
agcgccgcgccgttgcgtatcgcgctggcagcaccgacaggcaaggccgcggcccggctg
caggaagcggtgcagctggaggtcaaccagctggatgccgtcgaccggtcgcggttggcc
gggttgcaggcgaccacgctgcatcgtctgttgggatcgcgccccgacacgtcgtcccgg
ttcaaacatgatcgcggaaaccggttgccgcacgatgtgattgtggtggacgagacgtcg
atggtgtcgctgaccatgatggcgcgactgttggaggcggtgcgcccgcaggcccgactg
ctgctggtgggtgatcctgatcagctggcctcggtggaggcgggcgcggtgctggccgat
ctggtcgagggcctggagtccgaacgggtggcggcactgcgcacgtcgcaccgtttcggt
gcggcgattggcgcgttggcggcggcggtgcgtgacggagacgcggatcgcgcgctagag
gtgctggcatctggcgatccgcatgtggagtggtcgacggattcagaggggttacgcgat
gtgcttgtcccccaggcacttgcattgcgtgcggcaagcctgtccggtgatgccacagcg
gcgctggccgtgctcgacgagcaccggatgctatgcgcgcatcgccacgggccgttcggg
gtgacgcactggaaccgccaggtggagcggtggatcaccgaggagacgggcgagccgcac
tgggcaccctggtatgcgggaagaccgatcctggtcaccgccaatgactatggcttgcgt
ctgtacaacggtgacaccggcgtgacggtggccggacctgacgggctgcgcgcggtgatc
ggcgcagcatcgtttgcgaccagccgtctggttgaggtggagaccatgcacgccatgacc
attcacaagtcccagggcagccaggcgaatgaagtgacggtgctgctgccgtctgaagat
tcccggctgctgacacgcgagctgttctacacggcggtcacgcgcgccaagcagcgcgtg
cgggtggtgggctcggaggccgaggtgcgggccgcgatccagcggcaggcggtgcgggcg
tcggggttggggcggcgactgcgccacagcccgaactga

DBGET integrated database retrieval system