KEGG   Mycobacterium abscessus ATCC 19977: MAB_0534Help
Entry
MAB_0534          CDS       T00657                                 

Definition
GTP cyclohydrolase I (FolE)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAB_0534
Enzymes [BR:mab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MAB_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536541..537155
Genome map
AA seq 204 aa AA seqDB search
MNSPETAEYNGHPTGHVFDQARAEAAVRELLYAVGEDPDRHGLADTPARVARAYREIFAG
LYTDPDTVLNTTFDEQHDELVLVKSIPMYSTCEHHLVSFHGVAHVGYIPGQHGRVTGLSK
IARLVDLYAKRPQVQERLTAQIADALVRKLEPRGVIVVVEAEHLCMAMRGVRKPGATTTT
SAVRGQFKRDAASRAEVLDLMMRT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgcccgagacggccgagtacaacggccatccgaccggtcacgtcttcgaccag
gcacgtgccgaggccgcggtccgtgaactgctctatgcggtgggtgaagacccggatcgg
catggcttggcggatacaccggcccgcgtcgcgcgtgcgtacagggagattttcgccggg
ctctacaccgatccggataccgtgctgaacaccaccttcgacgagcagcatgacgagctg
gtgttggtgaagtcgataccgatgtactcgacgtgtgaacatcacctggtgtcgttccac
ggcgtcgcacatgtcggatacatccccggccagcacggccgcgtcacggggctctcgaaa
atcgctcgcttggttgacctttacgcgaaacgaccgcaggtgcaggagcgtctgacagcg
cagatcgccgacgcgctggtgcgcaagctcgagccgcgcggagtgatcgtcgtggtggaa
gccgagcatctgtgcatggccatgcgcggcgtacgcaagcccggtgcgactaccacgacc
tccgccgtacggggtcagttcaaacgtgacgccgcttcccgggccgaggttcttgacttg
atgatgaggacatga

DBGET integrated database retrieval system