KEGG   Mycobacterium abscessus ATCC 19977: MAB_0537Help
Entry
MAB_0537          CDS       T00657                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (FolK)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAB_0537
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MAB_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538584..539102
Genome map
AA seq 172 aa AA seqDB search
MRAVLSIGSNVGDRLAHLQSVVDALGSDVVGVSPVYQTAPWGHVPQPDFFNAIVVADGRE
PLEWLAVAHRLEQSAQRLRDERWGPRTLDVDVISCRRHDAGEVLSDDPDLTLPHPRAHLR
AFVLVPWLALEPGAVLTVDGVVRPVADLLSGLDAAEREGVRRMDAALTGPVT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgccgtgctttcgatcggctccaatgtcggtgacaggctcgcgcacctgcaatcg
gtggtggacgcactgggctcggacgtggtcggcgtctcgccggtgtatcagaccgctccg
tgggggcatgttccgcagccggacttcttcaacgcaatcgtcgtcgccgacggacgcgag
cccctggagtggcttgcggtggcgcaccgcctggagcagtcggcgcagcgattgcgcgac
gagcgttggggtccaaggactctcgacgttgatgtgatcagctgtcgtcgccatgatgct
ggtgaggtcctttccgatgacccggatctcacgctgccgcatccgcgtgcgcatctgcgg
gccttcgtgctggtgccgtggctggcgctggagcccggcgcggtactcaccgtcgacggt
gtggtgcgcccggtggccgacctgctgtccggactcgacgcggccgaacgcgagggtgtg
cggcggatggatgccgccctgaccggtccggtgacgtag

DBGET integrated database retrieval system